BLASTX nr result
ID: Angelica23_contig00008669
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00008669 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD33127.1| Hemopexin [Medicago truncatula] 42 4e-06 >gb|ABD33127.1| Hemopexin [Medicago truncatula] Length = 236 Score = 42.0 bits (97), Expect(2) = 4e-06 Identities = 15/28 (53%), Positives = 24/28 (85%) Frame = +1 Query: 205 KEKSKQLWLKEGDQNSKFFHVAASARKR 288 K+++K W+K+GD N+KFFH AA++RK+ Sbjct: 192 KQRAKIFWMKDGDMNAKFFHAAATSRKQ 219 Score = 33.5 bits (75), Expect(2) = 4e-06 Identities = 13/39 (33%), Positives = 25/39 (64%) Frame = +3 Query: 30 KIKSCSEKLMIWGKYYKGNFKERINECKKVQKGLKGRKD 146 +++ C+E+L WG+ + +KE I +CK + + L+G D Sbjct: 128 RLQHCTEELDQWGRSLRKRYKEDIQKCKDIIEELQGLGD 166