BLASTX nr result
ID: Angelica23_contig00008650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Angelica23_contig00008650 (621 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putativ... 78 1e-12 sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subun... 78 1e-12 ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group] g... 77 2e-12 ref|XP_003570359.1| PREDICTED: cytochrome c oxidase subunit 5C-l... 77 3e-12 ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [S... 77 3e-12 >ref|XP_002515282.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|255559374|ref|XP_002520707.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223540092|gb|EEF41669.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] gi|223545762|gb|EEF47266.1| Cytochrome c oxidase polypeptide Vc, putative [Ricinus communis] Length = 63 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 160 MAGGRVAHATLTGPSVVKEIVIATVLGMCAGGLWKMHHWNEQ 285 MAGGR+AHATL GPSVVKEI I LG+ AGGLWKMHHWNEQ Sbjct: 1 MAGGRIAHATLKGPSVVKEICIGIALGLAAGGLWKMHHWNEQ 42 >sp|Q8VY39.1|CX5C2_HELAN RecName: Full=Cytochrome c oxidase subunit 5C-2; AltName: Full=Cytochrome c oxidase polypeptide Vc-2 gi|18409602|gb|AAL67939.1| cytochrome c oxidase subunit 5c [Helianthus annuus] Length = 64 Score = 77.8 bits (190), Expect = 1e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 160 MAGGRVAHATLTGPSVVKEIVIATVLGMCAGGLWKMHHWNEQ 285 M GGRVAH L GPSVVKE+VI TVLG+ AGGLWKMHHWNEQ Sbjct: 1 MGGGRVAHPVLKGPSVVKELVIGTVLGLAAGGLWKMHHWNEQ 42 >ref|NP_001067021.1| Os12g0561000 [Oryza sativa Japonica Group] gi|48428177|sp|Q9SXX7.3|COX5C_ORYSJ RecName: Full=Cytochrome c oxidase subunit 5C; AltName: Full=Cytochrome c oxidase polypeptide Vc gi|4850330|dbj|BAA77682.1| cytochrome c oxidase subunit 5c [Oryza sativa Japonica Group] gi|113649528|dbj|BAF30040.1| Os12g0561000 [Oryza sativa Japonica Group] gi|125579724|gb|EAZ20870.1| hypothetical protein OsJ_36508 [Oryza sativa Japonica Group] Length = 63 Score = 77.4 bits (189), Expect = 2e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 160 MAGGRVAHATLTGPSVVKEIVIATVLGMCAGGLWKMHHWNEQ 285 MAGGR+AHATL GPSVVKEI I LG+ AGGLWKMHHWNEQ Sbjct: 1 MAGGRIAHATLKGPSVVKEICIGLTLGLVAGGLWKMHHWNEQ 42 >ref|XP_003570359.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] gi|357137543|ref|XP_003570360.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] gi|357137545|ref|XP_003570361.1| PREDICTED: cytochrome c oxidase subunit 5C-like [Brachypodium distachyon] Length = 63 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 160 MAGGRVAHATLTGPSVVKEIVIATVLGMCAGGLWKMHHWNEQ 285 MAGGRVAHATL GPSVVKEI I LG+ AGG+WKMHHWNEQ Sbjct: 1 MAGGRVAHATLKGPSVVKEIFIGLTLGLVAGGMWKMHHWNEQ 42 >ref|XP_002443358.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] gi|241944051|gb|EES17196.1| hypothetical protein SORBIDRAFT_08g018180 [Sorghum bicolor] Length = 63 Score = 77.0 bits (188), Expect = 3e-12 Identities = 34/42 (80%), Positives = 36/42 (85%) Frame = +1 Query: 160 MAGGRVAHATLTGPSVVKEIVIATVLGMCAGGLWKMHHWNEQ 285 MAGGRVAHATL GPSVVKEI I LG+ AGG+WKMHHWNEQ Sbjct: 1 MAGGRVAHATLKGPSVVKEIFIGMTLGLIAGGMWKMHHWNEQ 42