BLASTX nr result
ID: Anemarrhena21_contig00072999
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00072999 (298 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010266724.1| PREDICTED: cation/calcium exchanger 1-like [... 60 6e-07 ref|XP_010918006.1| PREDICTED: cation/calcium exchanger 1-like [... 60 8e-07 ref|XP_008812065.1| PREDICTED: cation/calcium exchanger 1-like [... 57 4e-06 ref|XP_008791218.1| PREDICTED: cation/calcium exchanger 1-like [... 57 6e-06 ref|XP_010909402.1| PREDICTED: cation/calcium exchanger 1-like [... 56 8e-06 >ref|XP_010266724.1| PREDICTED: cation/calcium exchanger 1-like [Nelumbo nucifera] Length = 602 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 296 ALVILPRKEMKLDRVLGIGLLAIYLCFLTLR 204 ALVILPRKEM+LD+VLG+GLLAIYLCFLTLR Sbjct: 553 ALVILPRKEMRLDKVLGVGLLAIYLCFLTLR 583 >ref|XP_010918006.1| PREDICTED: cation/calcium exchanger 1-like [Elaeis guineensis] Length = 559 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 296 ALVILPRKEMKLDRVLGIGLLAIYLCFLTLR 204 ALVILPRK+MKLDRVLG+GLLAIYLCFL+LR Sbjct: 519 ALVILPRKDMKLDRVLGVGLLAIYLCFLSLR 549 >ref|XP_008812065.1| PREDICTED: cation/calcium exchanger 1-like [Phoenix dactylifera] Length = 560 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 296 ALVILPRKEMKLDRVLGIGLLAIYLCFLTLR 204 ALV+LPRKEMKLDR+LG GLLAIY CFL+LR Sbjct: 520 ALVVLPRKEMKLDRILGFGLLAIYFCFLSLR 550 >ref|XP_008791218.1| PREDICTED: cation/calcium exchanger 1-like [Phoenix dactylifera] Length = 558 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 296 ALVILPRKEMKLDRVLGIGLLAIYLCFLTLR 204 ALVILPRK+MKLD VLG+GLLAIYLCFL LR Sbjct: 518 ALVILPRKDMKLDSVLGVGLLAIYLCFLCLR 548 >ref|XP_010909402.1| PREDICTED: cation/calcium exchanger 1-like [Elaeis guineensis] Length = 562 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 296 ALVILPRKEMKLDRVLGIGLLAIYLCFLTLR 204 ALV+LPRK+MKLDR+LG GLLAIY CFL+LR Sbjct: 522 ALVVLPRKDMKLDRILGFGLLAIYFCFLSLR 552