BLASTX nr result
ID: Anemarrhena21_contig00072935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00072935 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009392040.1| PREDICTED: lipid transfer-like protein VAS [... 60 6e-07 >ref|XP_009392040.1| PREDICTED: lipid transfer-like protein VAS [Musa acuminata subsp. malaccensis] Length = 139 Score = 60.1 bits (144), Expect = 6e-07 Identities = 24/63 (38%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -3 Query: 251 CCGPLGYVINHMLDCLCAIALNDPMMSYLNVTFEDVITLPNRCNMETPDVSKCSF-LDMP 75 CC PLG ++ ++CLC + +D ++ LN++ ++ P RC ++ PDV+KC F D P Sbjct: 55 CCVPLGSALDEEIECLCKLFFDDHLLESLNISQSQILGFPPRCGLKAPDVTKCKFSSDAP 114 Query: 74 KVN 66 K N Sbjct: 115 KPN 117