BLASTX nr result
ID: Anemarrhena21_contig00072913
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00072913 (292 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010692915.1| PREDICTED: probable leucine-rich repeat rece... 150 4e-34 gb|KJB67507.1| hypothetical protein B456_010G194100 [Gossypium r... 149 7e-34 ref|XP_012451818.1| PREDICTED: probable leucine-rich repeat rece... 149 7e-34 ref|XP_011015296.1| PREDICTED: probably inactive leucine-rich re... 149 7e-34 ref|XP_002315129.2| leucine-rich repeat transmembrane protein ki... 149 7e-34 ref|XP_012086644.1| PREDICTED: probable leucine-rich repeat rece... 149 9e-34 ref|XP_010257016.1| PREDICTED: probably inactive leucine-rich re... 148 1e-33 ref|XP_011084863.1| PREDICTED: LOW QUALITY PROTEIN: probable leu... 147 2e-33 ref|XP_010534629.1| PREDICTED: probable leucine-rich repeat rece... 147 2e-33 ref|XP_002520798.1| Nodulation receptor kinase precursor, putati... 147 3e-33 ref|XP_009139120.1| PREDICTED: probable leucine-rich repeat rece... 147 3e-33 ref|XP_008456892.1| PREDICTED: probable leucine-rich repeat rece... 147 3e-33 ref|XP_007163586.1| hypothetical protein PHAVU_001G246800g [Phas... 147 3e-33 ref|XP_004984886.1| PREDICTED: probably inactive leucine-rich re... 147 3e-33 ref|XP_004146459.1| PREDICTED: probable leucine-rich repeat rece... 147 3e-33 ref|XP_010087029.1| Probably inactive leucine-rich repeat recept... 146 5e-33 gb|KDO44837.1| hypothetical protein CISIN_1g008031mg [Citrus sin... 146 6e-33 ref|XP_006435829.1| hypothetical protein CICLE_v10030707mg [Citr... 146 6e-33 tpg|DAA44911.1| TPA: putative leucine-rich repeat receptor-like ... 146 6e-33 ref|XP_008646645.1| PREDICTED: uncharacterized protein LOC100384... 146 6e-33 >ref|XP_010692915.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 [Beta vulgaris subsp. vulgaris] gi|870847002|gb|KMS99457.1| hypothetical protein BVRB_2g044560 [Beta vulgaris subsp. vulgaris] Length = 789 Score = 150 bits (378), Expect = 4e-34 Identities = 72/84 (85%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP VFTADDLLCATAEI+GKSTYGTVY+ATLEDGS+VAVKRLREK KG KEFE Sbjct: 479 LVHFDGPMVFTADDLLCATAEIMGKSTYGTVYKATLEDGSEVAVKRLREKITKGQKEFEA 538 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +GK RHPNLL LRAYYLGPK Sbjct: 539 EVNLLGKIRHPNLLALRAYYLGPK 562 >gb|KJB67507.1| hypothetical protein B456_010G194100 [Gossypium raimondii] Length = 824 Score = 149 bits (376), Expect = 7e-34 Identities = 72/84 (85%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP VFTADDLLCATAEI+GKSTYGTVY+ATLEDG+QVAVKRLREK KG KEFE Sbjct: 533 LVHFDGPMVFTADDLLCATAEIMGKSTYGTVYKATLEDGNQVAVKRLREKITKGQKEFES 592 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +GK RHPNLL LRAYYLGPK Sbjct: 593 EVNVLGKIRHPNLLALRAYYLGPK 616 >ref|XP_012451818.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 [Gossypium raimondii] gi|763800551|gb|KJB67506.1| hypothetical protein B456_010G194100 [Gossypium raimondii] Length = 846 Score = 149 bits (376), Expect = 7e-34 Identities = 72/84 (85%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP VFTADDLLCATAEI+GKSTYGTVY+ATLEDG+QVAVKRLREK KG KEFE Sbjct: 533 LVHFDGPMVFTADDLLCATAEIMGKSTYGTVYKATLEDGNQVAVKRLREKITKGQKEFES 592 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +GK RHPNLL LRAYYLGPK Sbjct: 593 EVNVLGKIRHPNLLALRAYYLGPK 616 >ref|XP_011015296.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Populus euphratica] gi|743879225|ref|XP_011035864.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Populus euphratica] Length = 863 Score = 149 bits (376), Expect = 7e-34 Identities = 72/84 (85%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP VFTADDLLCATAEI+GKSTYGTVY+ATLEDGSQVAVKRLREK KG +EFE Sbjct: 553 LVHFDGPMVFTADDLLCATAEIMGKSTYGTVYKATLEDGSQVAVKRLREKITKGQREFES 612 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +GK RHPNLL LRAYYLGPK Sbjct: 613 EVNVLGKIRHPNLLALRAYYLGPK 636 >ref|XP_002315129.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550330135|gb|EEF01300.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 810 Score = 149 bits (376), Expect = 7e-34 Identities = 72/84 (85%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP VFTADDLLCATAEI+GKSTYGTVYRATLEDG+QVAVKRLREK KG +EFE Sbjct: 500 LVHFDGPMVFTADDLLCATAEIMGKSTYGTVYRATLEDGNQVAVKRLREKITKGQREFES 559 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +GK RHPNLL LRAYYLGPK Sbjct: 560 EVNVLGKIRHPNLLALRAYYLGPK 583 >ref|XP_012086644.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 [Jatropha curcas] gi|643738879|gb|KDP44693.1| hypothetical protein JCGZ_01193 [Jatropha curcas] Length = 754 Score = 149 bits (375), Expect = 9e-34 Identities = 71/84 (84%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEI+GKSTYGTVY+ATLEDGSQVAVKRLREK KG +EFE Sbjct: 444 LVHFDGPVAFTADDLLCATAEIMGKSTYGTVYKATLEDGSQVAVKRLREKITKGQREFEN 503 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN++GK RHPNLL LRAYYLGPK Sbjct: 504 EVNALGKIRHPNLLALRAYYLGPK 527 >ref|XP_010257016.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Nelumbo nucifera] Length = 866 Score = 148 bits (374), Expect = 1e-33 Identities = 71/84 (84%), Positives = 77/84 (91%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEI+GKSTYGTVY+ATLEDG+QVAVKRLREK AK +EFEV Sbjct: 559 LVHFDGPLAFTADDLLCATAEIMGKSTYGTVYKATLEDGNQVAVKRLREKIAKTQREFEV 618 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN++GK RHPNLL LRAYYLGPK Sbjct: 619 EVNTLGKIRHPNLLALRAYYLGPK 642 >ref|XP_011084863.1| PREDICTED: LOW QUALITY PROTEIN: probable leucine-rich repeat receptor-like protein kinase IMK3 [Sesamum indicum] Length = 808 Score = 147 bits (372), Expect = 2e-33 Identities = 69/84 (82%), Positives = 77/84 (91%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP VF+ADDLLCATAEI+GKSTYGTVY+AT+EDG QVAVKRLREK KG +EFE+ Sbjct: 501 LVHFDGPLVFSADDLLCATAEIMGKSTYGTVYKATMEDGIQVAVKRLREKITKGQREFEI 560 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN++GK RHPNLL LRAYYLGPK Sbjct: 561 EVNALGKIRHPNLLALRAYYLGPK 584 >ref|XP_010534629.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 [Tarenaya hassleriana] Length = 796 Score = 147 bits (372), Expect = 2e-33 Identities = 71/84 (84%), Positives = 75/84 (89%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEI+GKSTYGTVY+ATLEDGSQVAVKRLREK KG KEFE Sbjct: 489 LVHFDGPMAFTADDLLCATAEIMGKSTYGTVYKATLEDGSQVAVKRLREKITKGQKEFES 548 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +G+ RHPNLL LRAYYLGPK Sbjct: 549 EVNVLGRIRHPNLLALRAYYLGPK 572 >ref|XP_002520798.1| Nodulation receptor kinase precursor, putative [Ricinus communis] gi|223539929|gb|EEF41507.1| Nodulation receptor kinase precursor, putative [Ricinus communis] Length = 624 Score = 147 bits (371), Expect = 3e-33 Identities = 70/84 (83%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEI+GKSTYGTVY+ATLEDG+QVAVKRLREK KG +EFE Sbjct: 314 LVHFDGPLAFTADDLLCATAEIMGKSTYGTVYKATLEDGNQVAVKRLREKITKGQREFEN 373 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN++GK RHPNLL LRAYYLGPK Sbjct: 374 EVNALGKIRHPNLLALRAYYLGPK 397 >ref|XP_009139120.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 [Brassica rapa] Length = 741 Score = 147 bits (370), Expect = 3e-33 Identities = 70/84 (83%), Positives = 75/84 (89%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEI+GKSTYGTVY+ATLEDGSQVAVKRLREK KG KEFE Sbjct: 428 LVHFDGPLAFTADDLLCATAEIMGKSTYGTVYKATLEDGSQVAVKRLREKITKGQKEFEN 487 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 E+N +G+ RHPNLL LRAYYLGPK Sbjct: 488 EINVLGRIRHPNLLALRAYYLGPK 511 >ref|XP_008456892.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 [Cucumis melo] Length = 838 Score = 147 bits (370), Expect = 3e-33 Identities = 71/84 (84%), Positives = 75/84 (89%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDG TVFTADDLLCATAEI+GKSTYGTVY+ATLEDG+QVAVKRLREK K KEFE Sbjct: 529 LVHFDGQTVFTADDLLCATAEIMGKSTYGTVYKATLEDGNQVAVKRLREKITKSQKEFEA 588 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +GK RHPNLL LRAYYLGPK Sbjct: 589 EVNILGKIRHPNLLALRAYYLGPK 612 >ref|XP_007163586.1| hypothetical protein PHAVU_001G246800g [Phaseolus vulgaris] gi|561037050|gb|ESW35580.1| hypothetical protein PHAVU_001G246800g [Phaseolus vulgaris] Length = 984 Score = 147 bits (370), Expect = 3e-33 Identities = 70/84 (83%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEI+GKSTYGTVY+A LEDGSQVAVKRLREK AKGP+EFE Sbjct: 681 LVHFDGPIAFTADDLLCATAEIMGKSTYGTVYKAILEDGSQVAVKRLREKIAKGPREFES 740 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EV+ +GK RHPN+L LRAYYLGPK Sbjct: 741 EVSVLGKIRHPNVLALRAYYLGPK 764 >ref|XP_004984886.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Setaria italica] Length = 831 Score = 147 bits (370), Expect = 3e-33 Identities = 71/84 (84%), Positives = 75/84 (89%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEILGKSTYGTVY+AT+EDGS VAVKRLREK AK KEFE Sbjct: 504 LVHFDGPLSFTADDLLCATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEA 563 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN++GK RHPNLL LRAYYLGPK Sbjct: 564 EVNALGKIRHPNLLALRAYYLGPK 587 >ref|XP_004146459.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase IMK3 [Cucumis sativus] gi|700195526|gb|KGN50703.1| hypothetical protein Csa_5G218200 [Cucumis sativus] Length = 844 Score = 147 bits (370), Expect = 3e-33 Identities = 71/84 (84%), Positives = 75/84 (89%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDG TVFTADDLLCATAEI+GKSTYGTVY+ATLEDG+QVAVKRLREK K KEFE Sbjct: 530 LVHFDGQTVFTADDLLCATAEIMGKSTYGTVYKATLEDGNQVAVKRLREKITKSQKEFEA 589 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +GK RHPNLL LRAYYLGPK Sbjct: 590 EVNILGKIRHPNLLALRAYYLGPK 613 >ref|XP_010087029.1| Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Morus notabilis] gi|587835071|gb|EXB25847.1| Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 [Morus notabilis] Length = 832 Score = 146 bits (369), Expect = 5e-33 Identities = 70/84 (83%), Positives = 74/84 (88%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP VFTADDLLCATAEI+GKSTYGTVY+ATLEDG QVAVKRLREK K KEFE Sbjct: 523 LVHFDGPVVFTADDLLCATAEIMGKSTYGTVYKATLEDGHQVAVKRLREKITKSQKEFET 582 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN +GK RHPNLL LRAYY+GPK Sbjct: 583 EVNVLGKIRHPNLLALRAYYMGPK 606 >gb|KDO44837.1| hypothetical protein CISIN_1g008031mg [Citrus sinensis] Length = 580 Score = 146 bits (368), Expect = 6e-33 Identities = 70/84 (83%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP +FTADDLLCATAEI+GKSTYGTVY+ATLEDGSQVAVKRLREK KG +EFE Sbjct: 273 LVHFDGPLMFTADDLLCATAEIMGKSTYGTVYKATLEDGSQVAVKRLREKITKGQREFES 332 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EV+ +GK RHPNLL LRAYYLGPK Sbjct: 333 EVSLLGKIRHPNLLALRAYYLGPK 356 >ref|XP_006435829.1| hypothetical protein CICLE_v10030707mg [Citrus clementina] gi|568866347|ref|XP_006486518.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase IMK2-like [Citrus sinensis] gi|557538025|gb|ESR49069.1| hypothetical protein CICLE_v10030707mg [Citrus clementina] Length = 836 Score = 146 bits (368), Expect = 6e-33 Identities = 70/84 (83%), Positives = 76/84 (90%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP +FTADDLLCATAEI+GKSTYGTVY+ATLEDGSQVAVKRLREK KG +EFE Sbjct: 529 LVHFDGPLMFTADDLLCATAEIMGKSTYGTVYKATLEDGSQVAVKRLREKITKGQREFES 588 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EV+ +GK RHPNLL LRAYYLGPK Sbjct: 589 EVSLLGKIRHPNLLALRAYYLGPK 612 >tpg|DAA44911.1| TPA: putative leucine-rich repeat receptor-like protein kinase family protein [Zea mays] Length = 613 Score = 146 bits (368), Expect = 6e-33 Identities = 71/84 (84%), Positives = 75/84 (89%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEILGKSTYGTVY+AT+EDGS VAVKRLREK AK KEFE Sbjct: 499 LVHFDGPLSFTADDLLCATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEP 558 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN++GK RHPNLL LRAYYLGPK Sbjct: 559 EVNALGKLRHPNLLALRAYYLGPK 582 >ref|XP_008646645.1| PREDICTED: uncharacterized protein LOC100384795 isoform X1 [Zea mays] gi|414866353|tpg|DAA44910.1| TPA: putative leucine-rich repeat receptor-like protein kinase family protein [Zea mays] Length = 826 Score = 146 bits (368), Expect = 6e-33 Identities = 71/84 (84%), Positives = 75/84 (89%) Frame = -1 Query: 253 LVHFDGPTVFTADDLLCATAEILGKSTYGTVYRATLEDGSQVAVKRLREKYAKGPKEFEV 74 LVHFDGP FTADDLLCATAEILGKSTYGTVY+AT+EDGS VAVKRLREK AK KEFE Sbjct: 499 LVHFDGPLSFTADDLLCATAEILGKSTYGTVYKATMEDGSYVAVKRLREKIAKSQKEFEP 558 Query: 73 EVNSIGKARHPNLLVLRAYYLGPK 2 EVN++GK RHPNLL LRAYYLGPK Sbjct: 559 EVNALGKLRHPNLLALRAYYLGPK 582