BLASTX nr result
ID: Anemarrhena21_contig00072813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00072813 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010935270.1| PREDICTED: cyclin-B2-2-like [Elaeis guineensis] 58 3e-06 gb|EMT08838.1| Cyclin-B2-2 [Aegilops tauschii] 57 6e-06 gb|EMS50247.1| Cyclin-B2-2 [Triticum urartu] 57 6e-06 >ref|XP_010935270.1| PREDICTED: cyclin-B2-2-like [Elaeis guineensis] Length = 440 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 260 LTGVHRKYSTYKFGCAAKSEPAFFLLDTRL 171 LTGV+RKYST++FGCAAKSEPA FL+DTRL Sbjct: 411 LTGVYRKYSTFRFGCAAKSEPALFLMDTRL 440 >gb|EMT08838.1| Cyclin-B2-2 [Aegilops tauschii] Length = 449 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 260 LTGVHRKYSTYKFGCAAKSEPAFFLLDTR 174 LTGVHRKYST+K+GCAAKSEPA FLLD R Sbjct: 419 LTGVHRKYSTFKYGCAAKSEPAAFLLDAR 447 >gb|EMS50247.1| Cyclin-B2-2 [Triticum urartu] Length = 419 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -1 Query: 260 LTGVHRKYSTYKFGCAAKSEPAFFLLDTR 174 LTGVHRKYST+K+GCAAKSEPA FLLD R Sbjct: 389 LTGVHRKYSTFKYGCAAKSEPAAFLLDAR 417