BLASTX nr result
ID: Anemarrhena21_contig00071400
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00071400 (353 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001798749.1| hypothetical protein SNOG_08438 [Phaeosphaer... 93 6e-17 ref|XP_003834430.1| similar to oxysterol binding protein [Leptos... 87 6e-15 gb|EMD89470.1| hypothetical protein COCHEDRAFT_1022785 [Bipolari... 80 4e-13 ref|XP_007686115.1| hypothetical protein COCMIDRAFT_90166 [Bipol... 80 5e-13 ref|XP_007703134.1| hypothetical protein COCSADRAFT_39901 [Bipol... 80 7e-13 ref|XP_003300111.1| hypothetical protein PTT_11267 [Pyrenophora ... 79 2e-12 ref|XP_001938897.1| hypothetical protein PTRG_08565 [Pyrenophora... 79 2e-12 ref|XP_008029576.1| hypothetical protein SETTUDRAFT_164982 [Seto... 77 4e-12 gb|EKG20344.1| Oxysterol-binding protein [Macrophomina phaseolin... 64 5e-08 ref|XP_007780175.1| hypothetical protein W97_04092 [Coniosporium... 62 1e-07 gb|KKY17247.1| putative oxysterol binding protein [Diplodia seri... 62 2e-07 ref|XP_007583877.1| putative oxysterol binding protein [Neofusic... 60 7e-07 ref|XP_007680278.1| hypothetical protein BAUCODRAFT_569252 [Baud... 60 7e-07 ref|XP_007785893.1| hypothetical protein EPUS_02220 [Endocarpon ... 57 5e-06 gb|EMF11546.1| Oxysterol-binding protein [Sphaerulina musiva SO2... 57 5e-06 gb|EME41754.1| hypothetical protein DOTSEDRAFT_73974 [Dothistrom... 57 6e-06 ref|XP_011121587.1| hypothetical protein AOL_s00078g22 [Arthrobo... 57 6e-06 >ref|XP_001798749.1| hypothetical protein SNOG_08438 [Phaeosphaeria nodorum SN15] gi|160702124|gb|EAT84714.2| hypothetical protein SNOG_08438 [Phaeosphaeria nodorum SN15] Length = 406 Score = 93.2 bits (230), Expect = 6e-17 Identities = 41/59 (69%), Positives = 48/59 (81%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+R+FF+R+DKFPLF+KLA K+GE VNDT TNGVW FDQEKAS AK PFH + PI E Sbjct: 346 WERKFFTRSDKFPLFQKLAGKVGEPVNDTQTNGVWSFDQEKASAAKSPFHPHVNPPIYE 404 >ref|XP_003834430.1| similar to oxysterol binding protein [Leptosphaeria maculans JN3] gi|312210979|emb|CBX91065.1| similar to oxysterol binding protein [Leptosphaeria maculans JN3] Length = 400 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/59 (61%), Positives = 47/59 (79%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+R FF+RTD+ PLFE+LASK+GE +NDT TNG+W+FDQ+KA A P+H D+ PI E Sbjct: 340 WNRAFFTRTDEHPLFEQLASKVGELINDTQTNGIWVFDQQKAKTATSPYHPDVVPPIYE 398 >gb|EMD89470.1| hypothetical protein COCHEDRAFT_1022785 [Bipolaris maydis C5] gi|477582619|gb|ENH99725.1| hypothetical protein COCC4DRAFT_84971 [Bipolaris maydis ATCC 48331] Length = 399 Score = 80.5 bits (197), Expect = 4e-13 Identities = 33/59 (55%), Positives = 46/59 (77%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+R+FF+R ++PLFE+LA+K+GE VND+ TNGVW FD++KA AK P+H + PI E Sbjct: 339 WERKFFTRATEYPLFEQLATKIGESVNDSQTNGVWSFDKQKADTAKSPYHPTVVPPIYE 397 >ref|XP_007686115.1| hypothetical protein COCMIDRAFT_90166 [Bipolaris oryzae ATCC 44560] gi|628187928|ref|XP_007707869.1| hypothetical protein COCCADRAFT_84341 [Bipolaris zeicola 26-R-13] gi|576923738|gb|EUC37853.1| hypothetical protein COCCADRAFT_84341 [Bipolaris zeicola 26-R-13] gi|576933880|gb|EUC47401.1| hypothetical protein COCMIDRAFT_90166 [Bipolaris oryzae ATCC 44560] gi|578489025|gb|EUN26462.1| hypothetical protein COCVIDRAFT_16492 [Bipolaris victoriae FI3] Length = 399 Score = 80.1 bits (196), Expect = 5e-13 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+R+FF+R ++PLFE+LA K+GE VND+ TNGVW FD++KA AK P+H + PI E Sbjct: 339 WERKFFTRATEYPLFEQLAKKIGESVNDSQTNGVWSFDKQKADTAKSPYHPTVVPPIYE 397 >ref|XP_007703134.1| hypothetical protein COCSADRAFT_39901 [Bipolaris sorokiniana ND90Pr] gi|451847919|gb|EMD61226.1| hypothetical protein COCSADRAFT_39901 [Bipolaris sorokiniana ND90Pr] Length = 399 Score = 79.7 bits (195), Expect = 7e-13 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+R+FF+R ++PLFE+LA K+GE VND TNGVW FD++KA AK P+H + PI E Sbjct: 339 WERKFFTRATEYPLFEQLAKKIGESVNDNQTNGVWSFDKQKADTAKSPYHPTVVPPIYE 397 >ref|XP_003300111.1| hypothetical protein PTT_11267 [Pyrenophora teres f. teres 0-1] gi|311325906|gb|EFQ91789.1| hypothetical protein PTT_11267 [Pyrenophora teres f. teres 0-1] Length = 399 Score = 78.6 bits (192), Expect = 2e-12 Identities = 31/59 (52%), Positives = 46/59 (77%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+R+FF+R ++P FE+LA+K+GE +ND+ TNGVW FD++KA+ AK P+H + PI E Sbjct: 339 WERKFFTRATEYPQFEQLATKIGESINDSQTNGVWTFDKQKATAAKSPYHPTVVPPIYE 397 >ref|XP_001938897.1| hypothetical protein PTRG_08565 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985996|gb|EDU51484.1| hypothetical protein PTRG_08565 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 399 Score = 78.6 bits (192), Expect = 2e-12 Identities = 32/59 (54%), Positives = 45/59 (76%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+R+FFSR ++P FE+LA+K+GE +ND TNGVW FD++KA+ AK P+H + PI E Sbjct: 339 WERKFFSRAKEYPQFEQLATKIGESINDGQTNGVWTFDKQKATTAKSPYHPTVVPPIYE 397 >ref|XP_008029576.1| hypothetical protein SETTUDRAFT_164982 [Setosphaeria turcica Et28A] gi|482805349|gb|EOA82435.1| hypothetical protein SETTUDRAFT_164982 [Setosphaeria turcica Et28A] Length = 399 Score = 77.0 bits (188), Expect = 4e-12 Identities = 33/59 (55%), Positives = 43/59 (72%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+R+FFSR +F LFE+LA K+GE +ND+ TNGVW FD++KA A PFH + PI E Sbjct: 339 WERKFFSRATEFRLFEQLAGKIGESINDSQTNGVWSFDKQKADAATRPFHPTVVPPIYE 397 >gb|EKG20344.1| Oxysterol-binding protein [Macrophomina phaseolina MS6] Length = 394 Score = 63.5 bits (153), Expect = 5e-08 Identities = 26/47 (55%), Positives = 37/47 (78%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKP 161 W+RR+F+RTD+FP+FEKLA+++ E + TNGVW FD EKA++ P Sbjct: 341 WERRYFTRTDEFPVFEKLAARIQEPIEADKTNGVWKFDSEKAAKYLP 387 >ref|XP_007780175.1| hypothetical protein W97_04092 [Coniosporium apollinis CBS 100218] gi|494827962|gb|EON64858.1| hypothetical protein W97_04092 [Coniosporium apollinis CBS 100218] Length = 402 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/54 (50%), Positives = 38/54 (70%), Gaps = 3/54 (5%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQ---VNDTLTNGVWIFDQEKASQAKPPFHE 149 W R FFSR++ P+FE L+ +LG + ++ TNG+W+FD EKA +AKPPF E Sbjct: 336 WVRTFFSRSESSPVFEALSKRLGSESVPIDKDKTNGIWMFDAEKAREAKPPFRE 389 >gb|KKY17247.1| putative oxysterol binding protein [Diplodia seriata] Length = 395 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/44 (59%), Positives = 34/44 (77%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQ 170 W RR+FSRTD+FP+FEKLA+++ E + TNGVW FD KA+Q Sbjct: 341 WQRRYFSRTDEFPVFEKLAARIQEPIEAEKTNGVWKFDPTKAAQ 384 >ref|XP_007583877.1| putative oxysterol binding protein [Neofusicoccum parvum UCRNP2] gi|485923521|gb|EOD48670.1| putative oxysterol binding protein [Neofusicoccum parvum UCRNP2] Length = 395 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/44 (54%), Positives = 35/44 (79%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQ 170 W+RR+F+RTD FP+FEKLA+++ E + TNGVW FD +KA++ Sbjct: 341 WERRYFTRTDDFPVFEKLAARIQEPIEADKTNGVWKFDPKKAAK 384 >ref|XP_007680278.1| hypothetical protein BAUCODRAFT_569252 [Baudoinia compniacensis UAMH 10762] gi|449297065|gb|EMC93084.1| hypothetical protein BAUCODRAFT_569252 [Baudoinia compniacensis UAMH 10762] Length = 402 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/63 (44%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGE-QVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W+RRFF+R K P+F+KL ++ + TNG+W+FD++KA AKPPF + ++E Sbjct: 341 WERRFFTRAQKLPVFDKLIKEVPYGSLEADQTNGIWVFDKDKALNAKPPF-----SALSE 395 Query: 124 ELK 116 ELK Sbjct: 396 ELK 398 >ref|XP_007785893.1| hypothetical protein EPUS_02220 [Endocarpon pusillum Z07020] gi|539441450|gb|ERF76681.1| hypothetical protein EPUS_02220 [Endocarpon pusillum Z07020] Length = 913 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/50 (48%), Positives = 35/50 (70%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFH 152 W+ +FFSR D P+FEKL + E+++ T+GVW FD+EK +A+ PFH Sbjct: 337 WEPKFFSRVDDAPVFEKLGTPQEEKLSPDKTSGVWKFDEEKFRKARVPFH 386 >gb|EMF11546.1| Oxysterol-binding protein [Sphaerulina musiva SO2202] Length = 400 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/63 (42%), Positives = 39/63 (61%), Gaps = 1/63 (1%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGE-QVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPINE 125 W FFSRTD P+F++L ++ ++ T G+W+FD KA AKPPF +P++E Sbjct: 340 WQSTFFSRTDSLPIFDQLIKEVPYGSLDKDQTGGIWVFDPTKAQNAKPPF-----SPLSE 394 Query: 124 ELK 116 ELK Sbjct: 395 ELK 397 >gb|EME41754.1| hypothetical protein DOTSEDRAFT_73974 [Dothistroma septosporum NZE10] Length = 400 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/52 (46%), Positives = 33/52 (63%), Gaps = 1/52 (1%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGE-QVNDTLTNGVWIFDQEKASQAKPPFHE 149 W+R FFS+ P+FEKL ++ + T G+W+FDQEKA AKPPF + Sbjct: 340 WNRTFFSQAKSLPIFEKLIKEVPSGSLEQEQTGGIWVFDQEKAKNAKPPFSQ 391 >ref|XP_011121587.1| hypothetical protein AOL_s00078g22 [Arthrobotrys oligospora ATCC 24927] gi|345566591|gb|EGX49533.1| hypothetical protein AOL_s00078g22 [Arthrobotrys oligospora ATCC 24927] Length = 376 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/57 (47%), Positives = 38/57 (66%) Frame = -2 Query: 301 WDRRFFSRTDKFPLFEKLASKLGEQVNDTLTNGVWIFDQEKASQAKPPFHEDIKTPI 131 W+ +FFS D+ PLFE+LAS L ++ T GVW FD++KA A PFH ++ TP+ Sbjct: 320 WEPKFFSNADEDPLFEELASGLNLKLQPDRTKGVWKFDRKKADLAVKPFHGEL-TPL 375