BLASTX nr result
ID: Anemarrhena21_contig00071384
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00071384 (211 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO20880.1| hypothetical protein M407DRAFT_29484 [Tulasnella ... 58 2e-06 >gb|KIO20880.1| hypothetical protein M407DRAFT_29484 [Tulasnella calospora MUT 4182] Length = 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/60 (45%), Positives = 37/60 (61%) Frame = -2 Query: 207 FPPWHIRLSEMFYDPMPPSRFFKSLFPKNFLPEESPSLLTEVDFRRALDLYAAADIKLGK 28 FPPW IRL+++FY+P+ RF L + L+ E DFRRALD +A D+K+GK Sbjct: 6 FPPWQIRLTDIFYEPLSTQRFVSFLLDR----RSDARLINEQDFRRALDQFAKVDMKVGK 61