BLASTX nr result
ID: Anemarrhena21_contig00071377
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00071377 (310 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003295892.1| hypothetical protein PTT_03631 [Pyrenophora ... 69 2e-09 ref|XP_007686671.1| hypothetical protein COCMIDRAFT_91767 [Bipol... 66 8e-09 ref|XP_007714218.1| hypothetical protein COCCADRAFT_38419 [Bipol... 66 8e-09 ref|XP_008031222.1| hypothetical protein SETTUDRAFT_24670 [Setos... 66 8e-09 gb|EMD97735.1| hypothetical protein COCHEDRAFT_1125554 [Bipolari... 66 8e-09 ref|XP_007704103.1| hypothetical protein COCSADRAFT_40508 [Bipol... 66 8e-09 ref|XP_003835196.1| hypothetical protein LEMA_uP045370.1 [Leptos... 65 2e-08 ref|XP_001934745.1| MSP domain containing protein [Pyrenophora t... 65 2e-08 ref|XP_001795418.1| hypothetical protein SNOG_05006 [Phaeosphaer... 65 2e-08 ref|XP_007924590.1| hypothetical protein MYCFIDRAFT_162825 [Pseu... 63 7e-08 ref|XP_007580871.1| putative msp domain containing protein [Neof... 63 9e-08 gb|EKG21325.1| Major sperm protein [Macrophomina phaseolina MS6] 62 1e-07 ref|XP_007784172.1| hypothetical protein W97_08113 [Coniosporium... 62 2e-07 gb|KIW05295.1| hypothetical protein PV09_03822 [Verruconis gallo... 61 3e-07 gb|KKY27407.1| putative msp domain containing protein [Diplodia ... 60 7e-07 gb|KMU72348.1| hypothetical protein CISG_02996 [Coccidioides imm... 59 2e-06 ref|XP_001244687.2| integral ER membrane protein Scs2 [Coccidioi... 59 2e-06 gb|EFW19964.1| conserved hypothetical protein [Coccidioides posa... 59 2e-06 ref|XP_003068259.1| MSP domain containing protein [Coccidioides ... 59 2e-06 ref|XP_007675913.1| hypothetical protein BAUCODRAFT_575649 [Baud... 58 3e-06 >ref|XP_003295892.1| hypothetical protein PTT_03631 [Pyrenophora teres f. teres 0-1] gi|311332397|gb|EFQ96012.1| hypothetical protein PTT_03631 [Pyrenophora teres f. teres 0-1] Length = 292 Score = 68.6 bits (166), Expect = 2e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDPPELGFKRPFQ EVSQ LRL+NPHSDPV Sbjct: 1 MSVELDPPELGFKRPFQHEVSQTLRLRNPHSDPV 34 >ref|XP_007686671.1| hypothetical protein COCMIDRAFT_91767 [Bipolaris oryzae ATCC 44560] gi|576933335|gb|EUC46863.1| hypothetical protein COCMIDRAFT_91767 [Bipolaris oryzae ATCC 44560] Length = 295 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDP ELGFKRPFQ EVSQ LRLKNPHSDPV Sbjct: 1 MSVELDPVELGFKRPFQHEVSQTLRLKNPHSDPV 34 >ref|XP_007714218.1| hypothetical protein COCCADRAFT_38419 [Bipolaris zeicola 26-R-13] gi|576917253|gb|EUC31482.1| hypothetical protein COCCADRAFT_38419 [Bipolaris zeicola 26-R-13] gi|578487109|gb|EUN24572.1| hypothetical protein COCVIDRAFT_105744 [Bipolaris victoriae FI3] Length = 296 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDP ELGFKRPFQ EVSQ LRLKNPHSDPV Sbjct: 1 MSVELDPVELGFKRPFQHEVSQTLRLKNPHSDPV 34 >ref|XP_008031222.1| hypothetical protein SETTUDRAFT_24670 [Setosphaeria turcica Et28A] gi|482804040|gb|EOA81165.1| hypothetical protein SETTUDRAFT_24670 [Setosphaeria turcica Et28A] Length = 294 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDP ELGFKRPFQ EVSQ LRLKNPHSDPV Sbjct: 1 MSVELDPVELGFKRPFQHEVSQTLRLKNPHSDPV 34 >gb|EMD97735.1| hypothetical protein COCHEDRAFT_1125554 [Bipolaris maydis C5] gi|477585782|gb|ENI02869.1| hypothetical protein COCC4DRAFT_82931 [Bipolaris maydis ATCC 48331] Length = 295 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDP ELGFKRPFQ EVSQ LRLKNPHSDPV Sbjct: 1 MSVELDPVELGFKRPFQHEVSQTLRLKNPHSDPV 34 >ref|XP_007704103.1| hypothetical protein COCSADRAFT_40508 [Bipolaris sorokiniana ND90Pr] gi|451846772|gb|EMD60081.1| hypothetical protein COCSADRAFT_40508 [Bipolaris sorokiniana ND90Pr] Length = 295 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDP ELGFKRPFQ EVSQ LRLKNPHSDPV Sbjct: 1 MSVELDPVELGFKRPFQHEVSQTLRLKNPHSDPV 34 >ref|XP_003835196.1| hypothetical protein LEMA_uP045370.1 [Leptosphaeria maculans JN3] gi|312211747|emb|CBX91831.1| hypothetical protein LEMA_uP045370.1 [Leptosphaeria maculans JN3] Length = 61 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MS+ELDP ELGFKRPFQ EVSQ LRLKNPHSDPV Sbjct: 1 MSLELDPVELGFKRPFQHEVSQTLRLKNPHSDPV 34 >ref|XP_001934745.1| MSP domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980624|gb|EDU47250.1| MSP domain containing protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 292 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDP ELGFKRPFQ EVSQ LRL+NPHSDPV Sbjct: 1 MSVELDPVELGFKRPFQHEVSQTLRLRNPHSDPV 34 >ref|XP_001795418.1| hypothetical protein SNOG_05006 [Phaeosphaeria nodorum SN15] gi|160706489|gb|EAT87397.2| hypothetical protein SNOG_05006 [Phaeosphaeria nodorum SN15] Length = 320 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDP ELGFKRPFQQEVS+ L LKNPHSDPV Sbjct: 1 MSVELDPVELGFKRPFQQEVSKTLHLKNPHSDPV 34 >ref|XP_007924590.1| hypothetical protein MYCFIDRAFT_162825 [Pseudocercospora fijiensis CIRAD86] gi|452984209|gb|EME83966.1| hypothetical protein MYCFIDRAFT_162825 [Pseudocercospora fijiensis CIRAD86] Length = 277 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL+PPELGFKRPF EVSQVLRL+NP+SDPV Sbjct: 1 MSVELNPPELGFKRPFTHEVSQVLRLRNPNSDPV 34 >ref|XP_007580871.1| putative msp domain containing protein [Neofusicoccum parvum UCRNP2] gi|485927710|gb|EOD51637.1| putative msp domain containing protein [Neofusicoccum parvum UCRNP2] Length = 290 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL PPELGFKRPF QEVSQ LRL+NP+SDPV Sbjct: 1 MSVELTPPELGFKRPFTQEVSQTLRLRNPNSDPV 34 >gb|EKG21325.1| Major sperm protein [Macrophomina phaseolina MS6] Length = 285 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL PPELGFKRPF QEVSQ LRL+NP+SDPV Sbjct: 1 MSVELTPPELGFKRPFTQEVSQSLRLRNPNSDPV 34 >ref|XP_007784172.1| hypothetical protein W97_08113 [Coniosporium apollinis CBS 100218] gi|494832662|gb|EON68855.1| hypothetical protein W97_08113 [Coniosporium apollinis CBS 100218] Length = 281 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL+P ELGFKRPF EVSQVLRLKNP+SDPV Sbjct: 1 MSVELEPVELGFKRPFSHEVSQVLRLKNPNSDPV 34 >gb|KIW05295.1| hypothetical protein PV09_03822 [Verruconis gallopava] gi|759228316|gb|KIW05296.1| hypothetical protein, variant [Verruconis gallopava] Length = 262 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVELDP EL FKRPF +EVSQ+LRL NPHSDPV Sbjct: 1 MSVELDPSELHFKRPFNREVSQILRLHNPHSDPV 34 >gb|KKY27407.1| putative msp domain containing protein [Diplodia seriata] Length = 280 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL PPELGFKRPF EVSQ LRL+NP+SDPV Sbjct: 1 MSVELTPPELGFKRPFTTEVSQSLRLRNPNSDPV 34 >gb|KMU72348.1| hypothetical protein CISG_02996 [Coccidioides immitis RMSCC 3703] Length = 290 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL+P ELGF+RPF QEV++ L L+NPHSDPV Sbjct: 1 MSVELEPAELGFRRPFNQEVTETLHLRNPHSDPV 34 >ref|XP_001244687.2| integral ER membrane protein Scs2 [Coccidioides immitis RS] gi|767022984|gb|EAS33104.3| integral ER membrane protein Scs2 [Coccidioides immitis RS] gi|859414804|gb|KMP08396.1| hypothetical protein CIRG_08077 [Coccidioides immitis RMSCC 2394] Length = 307 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL+P ELGF+RPF QEV++ L L+NPHSDPV Sbjct: 1 MSVELEPAELGFRRPFNQEVTETLHLRNPHSDPV 34 >gb|EFW19964.1| conserved hypothetical protein [Coccidioides posadasii str. Silveira] gi|855539377|gb|KMM73465.1| hypothetical protein CPAG_09754 [Coccidioides posadasii RMSCC 3488] Length = 307 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL+P ELGF+RPF QEV++ L L+NPHSDPV Sbjct: 1 MSVELEPAELGFRRPFNQEVTETLHLRNPHSDPV 34 >ref|XP_003068259.1| MSP domain containing protein [Coccidioides posadasii C735 delta SOWgp] gi|240107940|gb|EER26114.1| MSP domain containing protein [Coccidioides posadasii C735 delta SOWgp] Length = 319 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSVEL+P ELGF+RPF QEV++ L L+NPHSDPV Sbjct: 1 MSVELEPAELGFRRPFNQEVTETLHLRNPHSDPV 34 >ref|XP_007675913.1| hypothetical protein BAUCODRAFT_575649 [Baudoinia compniacensis UAMH 10762] gi|449301624|gb|EMC97635.1| hypothetical protein BAUCODRAFT_575649 [Baudoinia compniacensis UAMH 10762] Length = 307 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 103 MSVELDPPELGFKRPFQQEVSQVLRLKNPHSDPV 2 MSV+L+P ELGFKRPF EVSQVLRL NP SDPV Sbjct: 1 MSVDLEPAELGFKRPFNHEVSQVLRLHNPSSDPV 34