BLASTX nr result
ID: Anemarrhena21_contig00071293
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00071293 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007688783.1| hypothetical protein COCMIDRAFT_27033 [Bipol... 77 4e-12 ref|XP_007702108.1| hypothetical protein COCSADRAFT_38772 [Bipol... 77 4e-12 ref|XP_003305341.1| hypothetical protein PTT_18156 [Pyrenophora ... 76 1e-11 ref|XP_001933160.1| tropomyosin [Pyrenophora tritici-repentis Pt... 76 1e-11 ref|XP_001794013.1| hypothetical protein SNOG_03449 [Phaeosphaer... 76 1e-11 ref|XP_003833653.1| similar to tropomyosin [Leptosphaeria macula... 73 6e-11 gb|EME39582.1| hypothetical protein DOTSEDRAFT_75291 [Dothistrom... 71 2e-10 gb|EKG14617.1| hypothetical protein MPH_08197 [Macrophomina phas... 71 2e-10 gb|KKY16771.1| putative actin lateral binding protein [Diplodia ... 70 5e-10 ref|XP_007580552.1| putative actin lateral binding protein [Neof... 70 5e-10 ref|XP_007928841.1| hypothetical protein MYCFIDRAFT_49951 [Pseud... 70 5e-10 dbj|GAM88791.1| hypothetical protein ANO11243_068250 [fungal sp.... 68 3e-09 gb|EMF09880.1| hypothetical protein SEPMUDRAFT_150985 [Sphaeruli... 66 8e-09 ref|XP_007681683.1| hypothetical protein BAUCODRAFT_152564 [Baud... 65 2e-08 gb|KIW03352.1| hypothetical protein PV09_05560 [Verruconis gallo... 65 2e-08 ref|XP_001911379.1| hypothetical protein [Podospora anserina S m... 64 5e-08 gb|KEQ58279.1| hypothetical protein M437DRAFT_70111 [Aureobasidi... 63 7e-08 gb|KKY34412.1| putative actin lateral binding protein [Diaporthe... 62 1e-07 gb|KEQ84783.1| hypothetical protein M438DRAFT_317632 [Aureobasid... 62 1e-07 gb|KEQ75976.1| hypothetical protein M436DRAFT_70382 [Aureobasidi... 62 1e-07 >ref|XP_007688783.1| hypothetical protein COCMIDRAFT_27033 [Bipolaris oryzae ATCC 44560] gi|628225398|ref|XP_007715539.1| hypothetical protein COCCADRAFT_39570 [Bipolaris zeicola 26-R-13] gi|636600173|ref|XP_008031425.1| hypothetical protein SETTUDRAFT_157802 [Setosphaeria turcica Et28A] gi|451998481|gb|EMD90945.1| hypothetical protein COCHEDRAFT_1204095 [Bipolaris maydis C5] gi|477588893|gb|ENI05971.1| hypothetical protein COCC4DRAFT_39869 [Bipolaris maydis ATCC 48331] gi|482803685|gb|EOA80810.1| hypothetical protein SETTUDRAFT_157802 [Setosphaeria turcica Et28A] gi|576915891|gb|EUC30171.1| hypothetical protein COCCADRAFT_39570 [Bipolaris zeicola 26-R-13] gi|576931128|gb|EUC44695.1| hypothetical protein COCMIDRAFT_27033 [Bipolaris oryzae ATCC 44560] gi|578494666|gb|EUN32052.1| hypothetical protein COCVIDRAFT_12001 [Bipolaris victoriae FI3] Length = 161 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI Sbjct: 126 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 161 >ref|XP_007702108.1| hypothetical protein COCSADRAFT_38772 [Bipolaris sorokiniana ND90Pr] gi|451848667|gb|EMD61972.1| hypothetical protein COCSADRAFT_38772 [Bipolaris sorokiniana ND90Pr] Length = 161 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI Sbjct: 126 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 161 >ref|XP_003305341.1| hypothetical protein PTT_18156 [Pyrenophora teres f. teres 0-1] gi|311317684|gb|EFQ86570.1| hypothetical protein PTT_18156 [Pyrenophora teres f. teres 0-1] Length = 161 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQSRDQWE+KYEEMAKKYADTKKELDDFVKEIGNI Sbjct: 126 LEQSRDQWETKYEEMAKKYADTKKELDDFVKEIGNI 161 >ref|XP_001933160.1| tropomyosin [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978724|gb|EDU45350.1| tropomyosin [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 161 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQSRDQWE+KYEEMAKKYADTKKELDDFVKEIGNI Sbjct: 126 LEQSRDQWETKYEEMAKKYADTKKELDDFVKEIGNI 161 >ref|XP_001794013.1| hypothetical protein SNOG_03449 [Phaeosphaeria nodorum SN15] gi|111067534|gb|EAT88654.1| hypothetical protein SNOG_03449 [Phaeosphaeria nodorum SN15] Length = 161 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQSRDQWE+KYEEMAKKYADTKKELDDFVKEIGNI Sbjct: 126 LEQSRDQWETKYEEMAKKYADTKKELDDFVKEIGNI 161 >ref|XP_003833653.1| similar to tropomyosin [Leptosphaeria maculans JN3] gi|312210201|emb|CBX90288.1| similar to tropomyosin [Leptosphaeria maculans JN3] Length = 161 Score = 73.2 bits (178), Expect = 6e-11 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQ RDQWESKYEEMAKKY DTKKELDDFVKEIGNI Sbjct: 126 LEQDRDQWESKYEEMAKKYNDTKKELDDFVKEIGNI 161 >gb|EME39582.1| hypothetical protein DOTSEDRAFT_75291 [Dothistroma septosporum NZE10] Length = 161 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE SRDQWE+KYEEMAKKYADTKKELDDFV EIGNI Sbjct: 126 LEASRDQWETKYEEMAKKYADTKKELDDFVAEIGNI 161 >gb|EKG14617.1| hypothetical protein MPH_08197 [Macrophomina phaseolina MS6] Length = 161 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE RDQWESKYEEMAKKYADTKKELDDFV EIGNI Sbjct: 126 LEAERDQWESKYEEMAKKYADTKKELDDFVNEIGNI 161 >gb|KKY16771.1| putative actin lateral binding protein [Diplodia seriata] Length = 179 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE RDQWE+KYEEMAKKYADTKKELDDFV EIGNI Sbjct: 144 LEAERDQWEAKYEEMAKKYADTKKELDDFVNEIGNI 179 >ref|XP_007580552.1| putative actin lateral binding protein [Neofusicoccum parvum UCRNP2] gi|485928214|gb|EOD51979.1| putative actin lateral binding protein [Neofusicoccum parvum UCRNP2] Length = 174 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE RDQWE+KYEEMAKKYADTKKELDDFV EIGNI Sbjct: 139 LEAERDQWEAKYEEMAKKYADTKKELDDFVNEIGNI 174 >ref|XP_007928841.1| hypothetical protein MYCFIDRAFT_49951 [Pseudocercospora fijiensis CIRAD86] gi|452980620|gb|EME80381.1| hypothetical protein MYCFIDRAFT_49951 [Pseudocercospora fijiensis CIRAD86] Length = 161 Score = 70.1 bits (170), Expect = 5e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE +RDQWE+KYEEMAKKYADTKKELDDFV EIGNI Sbjct: 126 LEAARDQWETKYEEMAKKYADTKKELDDFVAEIGNI 161 >dbj|GAM88791.1| hypothetical protein ANO11243_068250 [fungal sp. No.11243] Length = 154 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE RDQWESKYEEMAKKY +TKKELDDFV EIGNI Sbjct: 119 LETERDQWESKYEEMAKKYTETKKELDDFVAEIGNI 154 >gb|EMF09880.1| hypothetical protein SEPMUDRAFT_150985 [Sphaerulina musiva SO2202] Length = 161 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE S QWE+KYEEMAKKYADTKKELDDFV EIGNI Sbjct: 126 LEASTGQWETKYEEMAKKYADTKKELDDFVAEIGNI 161 >ref|XP_007681683.1| hypothetical protein BAUCODRAFT_152564 [Baudoinia compniacensis UAMH 10762] gi|449295265|gb|EMC91287.1| hypothetical protein BAUCODRAFT_152564 [Baudoinia compniacensis UAMH 10762] Length = 161 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQS +QWE+KYE+MAKKYADTKKELDDFV EIG I Sbjct: 126 LEQSVNQWETKYEDMAKKYADTKKELDDFVAEIGTI 161 >gb|KIW03352.1| hypothetical protein PV09_05560 [Verruconis gallopava] Length = 161 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQS QWE+K+EEMAKKYADTKKELDDFV EIG I Sbjct: 126 LEQSNAQWEAKFEEMAKKYADTKKELDDFVAEIGTI 161 >ref|XP_001911379.1| hypothetical protein [Podospora anserina S mat+] gi|170946403|emb|CAP73204.1| unnamed protein product [Podospora anserina S mat+] gi|681095477|emb|CDP25606.1| Putative tropomyosin-2 [Podospora anserina S mat+] Length = 161 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LEQ RDQWESKYEEMAKKYA +KEL+DF EIGNI Sbjct: 126 LEQERDQWESKYEEMAKKYATVQKELEDFQNEIGNI 161 >gb|KEQ58279.1| hypothetical protein M437DRAFT_70111 [Aureobasidium melanogenum CBS 110374] Length = 161 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE +RDQWE+KYEEMA+KY TKKELDDFV EIGNI Sbjct: 126 LEAARDQWEAKYEEMAQKYNATKKELDDFVAEIGNI 161 >gb|KKY34412.1| putative actin lateral binding protein [Diaporthe ampelina] Length = 181 Score = 62.4 bits (150), Expect = 1e-07 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE RDQWESKYEEM+KKYAD KKEL++F EIGNI Sbjct: 146 LESERDQWESKYEEMSKKYADIKKELEEFQAEIGNI 181 >gb|KEQ84783.1| hypothetical protein M438DRAFT_317632 [Aureobasidium pullulans EXF-150] Length = 161 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE +RDQWE+KYEEMA KY TKKELDDFV EIGNI Sbjct: 126 LEAARDQWEAKYEEMAAKYNATKKELDDFVAEIGNI 161 >gb|KEQ75976.1| hypothetical protein M436DRAFT_70382 [Aureobasidium namibiae CBS 147.97] Length = 161 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -2 Query: 279 LEQSRDQWESKYEEMAKKYADTKKELDDFVKEIGNI 172 LE +RDQWE+KYEEMA KY TKKELDDFV EIGNI Sbjct: 126 LEAARDQWEAKYEEMATKYNMTKKELDDFVAEIGNI 161