BLASTX nr result
ID: Anemarrhena21_contig00071235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00071235 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007782418.1| hypothetical protein W97_06354 [Coniosporium... 63 7e-08 gb|KIW08811.1| hypothetical protein PV09_00744 [Verruconis gallo... 59 1e-06 >ref|XP_007782418.1| hypothetical protein W97_06354 [Coniosporium apollinis CBS 100218] gi|494830576|gb|EON67101.1| hypothetical protein W97_06354 [Coniosporium apollinis CBS 100218] Length = 1158 Score = 63.2 bits (152), Expect = 7e-08 Identities = 33/71 (46%), Positives = 44/71 (61%) Frame = -3 Query: 225 LVASSDPALSPAXXXXXXXXXHSPGADKDLKDEPMYTVGTTSDPSIIPAQSPLDHHLHRR 46 LV ++DPAL A H+P A D D Y++ TT++PSIIPAQ PLD +L RR Sbjct: 19 LVLNNDPALDTAHEHHHGHMHHAPSAAHD--DNVTYSINTTAEPSIIPAQDPLDDNLRRR 76 Query: 45 GHPERKRSHDK 13 GHPE+ +D+ Sbjct: 77 GHPEKNGHYDE 87 >gb|KIW08811.1| hypothetical protein PV09_00744 [Verruconis gallopava] Length = 652 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/70 (45%), Positives = 39/70 (55%) Frame = -3 Query: 237 EKSHLVASSDPALSPAXXXXXXXXXHSPGADKDLKDEPMYTVGTTSDPSIIPAQSPLDHH 58 EKS L + D AL P+ HS A+K D+ +YT GTT +P +IP Q D Sbjct: 3 EKSQLAHNPDLALHPSREHHHEHLHHSAAAEKGRTDDVVYTKGTTDEPGVIPPQDINDDS 62 Query: 57 LHRRGHPERK 28 LHRR HPERK Sbjct: 63 LHRRHHPERK 72