BLASTX nr result
ID: Anemarrhena21_contig00071104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00071104 (219 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO17348.1| hypothetical protein M407DRAFT_85086 [Tulasnella ... 59 1e-06 >gb|KIO17348.1| hypothetical protein M407DRAFT_85086 [Tulasnella calospora MUT 4182] Length = 379 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/52 (53%), Positives = 37/52 (71%) Frame = -3 Query: 184 PIRQSSLEVPFVRLHTSASDLLSTCQRAFRQRERDANIIYPFAIKSPLSSEQ 29 PIR+ +L+ FVR H +A+ LL++CQ F RERDANII PFAIK+ + Q Sbjct: 2 PIRRPTLDTTFVRYHPTAASLLASCQNDFMLRERDANIILPFAIKTKYAEPQ 53