BLASTX nr result
ID: Anemarrhena21_contig00071048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00071048 (278 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008023550.1| hypothetical protein SETTUDRAFT_168133 [Seto... 94 4e-17 ref|XP_003304728.1| hypothetical protein PTT_17377 [Pyrenophora ... 94 5e-17 ref|XP_001937962.1| thioredoxin reductase [Pyrenophora tritici-r... 94 5e-17 ref|XP_001805394.1| hypothetical protein SNOG_15235 [Phaeosphaer... 94 5e-17 ref|XP_007696478.1| hypothetical protein COCSADRAFT_33850 [Bipol... 93 6e-17 ref|XP_007684711.1| hypothetical protein COCMIDRAFT_23543 [Bipol... 93 8e-17 gb|EMD94483.1| hypothetical protein COCHEDRAFT_1153762 [Bipolari... 93 8e-17 ref|XP_003838904.1| hypothetical protein LEMA_P025770.1 [Leptosp... 90 5e-16 ref|XP_007779536.1| thioredoxin reductase [Coniosporium apollini... 85 2e-14 gb|EKG21989.1| Pyridine nucleotide-disulfide oxidoreductase clas... 76 8e-12 gb|KKY26182.1| putative thioredoxin reductase [Diplodia seriata] 70 4e-10 gb|ESZ98794.1| hypothetical protein SBOR_0843 [Sclerotinia borea... 69 9e-10 ref|XP_007753352.1| thioredoxin reductase [Cladophialophora yegr... 67 4e-09 gb|KIW00971.1| thioredoxin-disulfide reductase [Verruconis gallo... 67 6e-09 gb|KIV80092.1| thioredoxin reductase [Exophiala sideris] 67 6e-09 gb|KIW72689.1| thioredoxin reductase [Capronia semiimmersa] 66 1e-08 ref|XP_007580367.1| putative thioredoxin reductase protein [Neof... 66 1e-08 gb|EME38223.1| hypothetical protein DOTSEDRAFT_92325 [Dothistrom... 66 1e-08 ref|XP_008722803.1| thioredoxin reductase [Cladophialophora carr... 65 1e-08 ref|XP_007929768.1| hypothetical protein MYCFIDRAFT_58683 [Pseud... 65 1e-08 >ref|XP_008023550.1| hypothetical protein SETTUDRAFT_168133 [Setosphaeria turcica Et28A] gi|482812177|gb|EOA88909.1| hypothetical protein SETTUDRAFT_168133 [Setosphaeria turcica Et28A] Length = 356 Score = 94.0 bits (232), Expect = 4e-17 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEKWLA++DDSVTNELE E QAEKSQ NGVVPEYRSNPLL Sbjct: 307 AGSGCIAALEAEKWLAEKDDSVTNELETETQAEKSQTNGVVPEYRSNPLL 356 >ref|XP_003304728.1| hypothetical protein PTT_17377 [Pyrenophora teres f. teres 0-1] gi|311318610|gb|EFQ87229.1| hypothetical protein PTT_17377 [Pyrenophora teres f. teres 0-1] Length = 356 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEKWLA++DDSV NELE ENQAEKSQ NGVVPEYRSNPLL Sbjct: 307 AGSGCIAALEAEKWLAEKDDSVGNELETENQAEKSQTNGVVPEYRSNPLL 356 >ref|XP_001937962.1| thioredoxin reductase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985061|gb|EDU50549.1| thioredoxin reductase [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 329 Score = 93.6 bits (231), Expect = 5e-17 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEKWLA++DDSV NELE ENQAEKSQ NGVVPEYRSNPLL Sbjct: 280 AGSGCIAALEAEKWLAEKDDSVGNELETENQAEKSQTNGVVPEYRSNPLL 329 >ref|XP_001805394.1| hypothetical protein SNOG_15235 [Phaeosphaeria nodorum SN15] gi|160705088|gb|EAT77460.2| hypothetical protein SNOG_15235 [Phaeosphaeria nodorum SN15] Length = 355 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/50 (90%), Positives = 46/50 (92%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGCVAALEAEKWLA+ DDSV NELE ENQAEKSQ NGVVPEYRSNPLL Sbjct: 306 AGSGCVAALEAEKWLAEHDDSVGNELETENQAEKSQTNGVVPEYRSNPLL 355 >ref|XP_007696478.1| hypothetical protein COCSADRAFT_33850 [Bipolaris sorokiniana ND90Pr] gi|451853637|gb|EMD66930.1| hypothetical protein COCSADRAFT_33850 [Bipolaris sorokiniana ND90Pr] Length = 356 Score = 93.2 bits (230), Expect = 6e-17 Identities = 43/50 (86%), Positives = 48/50 (96%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGCVAALEAEKWLA++D+SV+NELE ENQAEKSQ NG+VPEYRSNPLL Sbjct: 307 AGSGCVAALEAEKWLAERDESVSNELETENQAEKSQTNGIVPEYRSNPLL 356 >ref|XP_007684711.1| hypothetical protein COCMIDRAFT_23543 [Bipolaris oryzae ATCC 44560] gi|628192586|ref|XP_007709006.1| hypothetical protein COCCADRAFT_2326 [Bipolaris zeicola 26-R-13] gi|477584080|gb|ENI01174.1| hypothetical protein COCC4DRAFT_26867 [Bipolaris maydis ATCC 48331] gi|576922546|gb|EUC36673.1| hypothetical protein COCCADRAFT_2326 [Bipolaris zeicola 26-R-13] gi|576935266|gb|EUC48772.1| hypothetical protein COCMIDRAFT_23543 [Bipolaris oryzae ATCC 44560] gi|578489345|gb|EUN26777.1| hypothetical protein COCVIDRAFT_16246 [Bipolaris victoriae FI3] Length = 356 Score = 92.8 bits (229), Expect = 8e-17 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEKWLA++D+SV+NELE ENQAEKSQ NG+VPEYRSNPLL Sbjct: 307 AGSGCIAALEAEKWLAERDESVSNELETENQAEKSQTNGIVPEYRSNPLL 356 >gb|EMD94483.1| hypothetical protein COCHEDRAFT_1153762 [Bipolaris maydis C5] Length = 355 Score = 92.8 bits (229), Expect = 8e-17 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEKWLA++D+SV+NELE ENQAEKSQ NG+VPEYRSNPLL Sbjct: 306 AGSGCIAALEAEKWLAERDESVSNELETENQAEKSQTNGIVPEYRSNPLL 355 >ref|XP_003838904.1| hypothetical protein LEMA_P025770.1 [Leptosphaeria maculans JN3] gi|312215473|emb|CBX95425.1| hypothetical protein LEMA_P025770.1 [Leptosphaeria maculans JN3] Length = 482 Score = 90.1 bits (222), Expect = 5e-16 Identities = 42/50 (84%), Positives = 45/50 (90%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEKWLA++D V NELE ENQAEKSQ NGVVPEYRSNPLL Sbjct: 433 AGSGCIAALEAEKWLAERDSGVDNELETENQAEKSQTNGVVPEYRSNPLL 482 >ref|XP_007779536.1| thioredoxin reductase [Coniosporium apollinis CBS 100218] gi|494827229|gb|EON64219.1| thioredoxin reductase [Coniosporium apollinis CBS 100218] Length = 356 Score = 84.7 bits (208), Expect = 2e-14 Identities = 40/50 (80%), Positives = 45/50 (90%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEK+LA+QD +V ELE ENQAEKSQ NG+VPEYRSNPLL Sbjct: 307 AGSGCIAALEAEKYLAEQDGTVEPELEAENQAEKSQTNGIVPEYRSNPLL 356 >gb|EKG21989.1| Pyridine nucleotide-disulfide oxidoreductase class-2 [Macrophomina phaseolina MS6] Length = 356 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/50 (68%), Positives = 42/50 (84%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEK+L + D+ V N+LE +N+ +KSQ NGVVPEYRSNP L Sbjct: 307 AGSGCIAALEAEKFLVENDEEVENKLEADNEVKKSQANGVVPEYRSNPTL 356 >gb|KKY26182.1| putative thioredoxin reductase [Diplodia seriata] Length = 355 Score = 70.5 bits (171), Expect = 4e-10 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AG+GC+AALEAEK++ + +D N LE E++ +KSQ NGVVPEYRSNP L Sbjct: 306 AGAGCIAALEAEKFIVEHEDGPENPLEAESETKKSQANGVVPEYRSNPTL 355 >gb|ESZ98794.1| hypothetical protein SBOR_0843 [Sclerotinia borealis F-4157] Length = 993 Score = 69.3 bits (168), Expect = 9e-10 Identities = 37/50 (74%), Positives = 43/50 (86%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEK+LA+Q+D+ N+LE ENQAEK N VVPEYRSNPLL Sbjct: 946 AGSGCIAALEAEKFLAEQEDT-ENDLEKENQAEKGS-NVVVPEYRSNPLL 993 >ref|XP_007753352.1| thioredoxin reductase [Cladophialophora yegresii CBS 114405] gi|589981544|gb|EXJ64785.1| thioredoxin reductase [Cladophialophora yegresii CBS 114405] Length = 359 Score = 67.4 bits (163), Expect = 4e-09 Identities = 33/51 (64%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNG-VVPEYRSNPLL 128 AGSGC+AALEAEK+LA+ +D ++E ENQA+K +VNG PEYRSNPLL Sbjct: 309 AGSGCIAALEAEKYLAELEDDDVPDIEKENQAKKPEVNGDAAPEYRSNPLL 359 >gb|KIW00971.1| thioredoxin-disulfide reductase [Verruconis gallopava] Length = 355 Score = 66.6 bits (161), Expect = 6e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AGSGC+AALEAEKWLA+Q+ T+ E + +KSQ N VVPEY+SNPLL Sbjct: 309 AGSGCIAALEAEKWLAEQESEETSH---EPEVKKSQANSVVPEYKSNPLL 355 >gb|KIV80092.1| thioredoxin reductase [Exophiala sideris] Length = 358 Score = 66.6 bits (161), Expect = 6e-09 Identities = 35/51 (68%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNG-VVPEYRSNPLL 128 AGSGC+AALEAEK+LAD +D N +E ENQA+K +VNG PEYRSNPLL Sbjct: 309 AGSGCIAALEAEKYLADLEDDEPN-IEKENQAKKPEVNGDAAPEYRSNPLL 358 >gb|KIW72689.1| thioredoxin reductase [Capronia semiimmersa] Length = 358 Score = 65.9 bits (159), Expect = 1e-08 Identities = 34/51 (66%), Positives = 42/51 (82%), Gaps = 1/51 (1%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNG-VVPEYRSNPLL 128 AGSGC+AALEAEK+LA+ +D V ++E ENQA+K +VNG PEYRSNPLL Sbjct: 309 AGSGCIAALEAEKYLAELEDDVP-DIEKENQAKKPEVNGDAAPEYRSNPLL 358 >ref|XP_007580367.1| putative thioredoxin reductase protein [Neofusicoccum parvum UCRNP2] gi|485928478|gb|EOD52185.1| putative thioredoxin reductase protein [Neofusicoccum parvum UCRNP2] Length = 356 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AG+GC+AALEAEK+L + +D LE + + +KSQ NGVVPEYRSNP L Sbjct: 307 AGAGCIAALEAEKFLVEAEDEAEVPLESDKEVKKSQANGVVPEYRSNPTL 356 >gb|EME38223.1| hypothetical protein DOTSEDRAFT_92325 [Dothistroma septosporum NZE10] Length = 358 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/52 (59%), Positives = 41/52 (78%), Gaps = 2/52 (3%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKS--QVNGVVPEYRSNPLL 128 AGSGC+AALEAEKWLA+ ++ V N +E +++ +K + NG VPEYRSNPLL Sbjct: 307 AGSGCMAALEAEKWLAENEEDVPNGIEGDSEVKKGKPEANGDVPEYRSNPLL 358 >ref|XP_008722803.1| thioredoxin reductase [Cladophialophora carrionii CBS 160.54] gi|565939623|gb|ETI28729.1| thioredoxin reductase [Cladophialophora carrionii CBS 160.54] Length = 359 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/51 (62%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNG-VVPEYRSNPLL 128 AGSGC+AALEAEK+LA+ +D ++E E+QA+K +VNG PEYRSNPLL Sbjct: 309 AGSGCIAALEAEKYLAELEDDDVPDIEKESQAKKPEVNGEAAPEYRSNPLL 359 >ref|XP_007929768.1| hypothetical protein MYCFIDRAFT_58683 [Pseudocercospora fijiensis CIRAD86] gi|452979845|gb|EME79607.1| hypothetical protein MYCFIDRAFT_58683 [Pseudocercospora fijiensis CIRAD86] Length = 355 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = -2 Query: 277 AGSGCVAALEAEKWLADQDDSVTNELEVENQAEKSQVNGVVPEYRSNPLL 128 AG+GC+AALEAEKWLA+ D V N +E +N A K +NG PEYRSNPLL Sbjct: 307 AGTGCMAALEAEKWLAENVDDVPNGVEADNVA-KRPINGEAPEYRSNPLL 355