BLASTX nr result
ID: Anemarrhena21_contig00069914
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069914 (377 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006955754.1| hypothetical protein WALSEDRAFT_61743 [Walle... 65 2e-08 >ref|XP_006955754.1| hypothetical protein WALSEDRAFT_61743 [Wallemia sebi CBS 633.66] gi|388583612|gb|EIM23913.1| hypothetical protein WALSEDRAFT_61743 [Wallemia sebi CBS 633.66] Length = 104 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/69 (44%), Positives = 37/69 (53%), Gaps = 5/69 (7%) Frame = -3 Query: 273 LDNVEQGIKGIWNVFHGAGEVIRGTLNDTADRGGDLITGRP-----HTGNEGAVASEGYN 109 +D ++ I+G W FHG GE IRGT N+T DR GD I GRP N A +G N Sbjct: 1 MDKIQDKIQGAWKGFHGTGETIRGTFNETVDRAGDQIAGRPAGSVESKSNNPGTAKKGIN 60 Query: 108 EISRGFSSL 82 E GF L Sbjct: 61 EFKDGFDKL 69