BLASTX nr result
ID: Anemarrhena21_contig00069827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069827 (297 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007276997.1| hypothetical protein CGGC5_6169 [Colletotric... 57 4e-06 >ref|XP_007276997.1| hypothetical protein CGGC5_6169 [Colletotrichum gloeosporioides Nara gc5] gi|429859159|gb|ELA33949.1| hypothetical protein CGGC5_6169 [Colletotrichum gloeosporioides Nara gc5] Length = 257 Score = 57.4 bits (137), Expect = 4e-06 Identities = 36/90 (40%), Positives = 51/90 (56%), Gaps = 1/90 (1%) Frame = -1 Query: 297 VDNVEWIFGNSTKKFKLKFYVLDDLPVDALLNNEFLIDINAFSDYNSAFFQLALAQDETN 118 V+N W G ST + F+VLD LP D +L+ ++L D+N FSDY +FF L +D T Sbjct: 128 VENAMWTVGEST--VQCDFHVLDGLPADIILSKDYLFDLNIFSDYADSFFDLDSVEDLT- 184 Query: 117 ELCAIAL-SKFSKRLKDLCDLYLGKKTSSD 31 LC I L + + L+ L + +L TS D Sbjct: 185 LLCGIRLVEEEIQDLEKLEEEFLRDVTSQD 214