BLASTX nr result
ID: Anemarrhena21_contig00069819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069819 (306 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFH73313.1| hypothetical protein MVEG_00531 [Mortierella vert... 58 3e-06 gb|EJT51965.1| hypothetical protein A1Q1_06771 [Trichosporon asa... 56 8e-06 >gb|KFH73313.1| hypothetical protein MVEG_00531 [Mortierella verticillata NRRL 6337] Length = 226 Score = 57.8 bits (138), Expect = 3e-06 Identities = 39/93 (41%), Positives = 48/93 (51%), Gaps = 6/93 (6%) Frame = -3 Query: 301 AGQNINVQWEIGAAHKG-QCFVELSTDGEKTFNLVQELPNCADVAGPNF---QASVKLP- 137 AGQ I +++GAAH G C LS D KT+ ++Q L PNF A+VK+P Sbjct: 82 AGQTIKTDYDVGAAHGGGHCQWALSYDNGKTWVVIQTLIRDCLRNVPNFGKYSANVKIPA 141 Query: 136 NTPCDNCVLRWRWE-ATLTGELYLNCADIKITG 41 N P W W A ELY NCADI+I G Sbjct: 142 NAPSGKVTFMWLWNNAVGNRELYSNCADIEIKG 174 >gb|EJT51965.1| hypothetical protein A1Q1_06771 [Trichosporon asahii var. asahii CBS 2479] gi|406699371|gb|EKD02576.1| hypothetical protein A1Q2_03172 [Trichosporon asahii var. asahii CBS 8904] Length = 363 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/90 (36%), Positives = 43/90 (47%), Gaps = 3/90 (3%) Frame = -3 Query: 301 AGQNINVQWEIGAAHKG-QCFVELSTDGEKTFNLVQEL-PNCADVAGPNFQASVKLPNTP 128 AGQN + + GA H G C LS DG KTF ++Q + NC P + P Sbjct: 79 AGQNYHFTLQGGANHAGGSCQASLSYDGGKTFTVIQSIVGNCPSTVAPTDYPVTVPGDAP 138 Query: 127 CDNCVLRWRWEATL-TGELYLNCADIKITG 41 + + W W L E+Y+NCA IKI G Sbjct: 139 SGDAIFAWTWFNNLGNREMYMNCAHIKING 168