BLASTX nr result
ID: Anemarrhena21_contig00069138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00069138 (229 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008083600.1| hypothetical protein GLAREA_00651 [Glarea lo... 89 1e-15 ref|XP_001547873.1| conserved hypothetical protein [Botrytis cin... 87 3e-15 ref|XP_009226059.1| plasma membrane proteolipid 3 [Gaeumannomyce... 87 4e-15 ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia... 87 4e-15 ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe o... 87 6e-15 emb|CCA68482.1| probable RIC1 protein [Piriformospora indica DSM... 86 1e-14 emb|CEJ91660.1| Putative Plasma membrane proteolipid 3 [Torrubie... 86 1e-14 gb|ERS97669.1| plasma membrane proteolipid 3 [Sporothrix schenck... 86 1e-14 gb|EHK25550.1| hypothetical protein TRIVIDRAFT_72673 [Trichoderm... 86 1e-14 ref|XP_001875355.1| predicted protein [Laccaria bicolor S238N-H8... 86 1e-14 gb|KFY70616.1| hypothetical protein V498_10298, partial [Pseudog... 85 2e-14 ref|XP_003009000.1| conserved hypothetical protein [Verticillium... 85 2e-14 ref|XP_008601865.1| plasma membrane proteolipid 3 [Beauveria bas... 85 2e-14 ref|XP_001910957.1| hypothetical protein [Podospora anserina S m... 85 2e-14 ref|XP_001539523.1| conserved hypothetical protein [Histoplasma ... 85 2e-14 ref|XP_006665500.1| stress response RCI peptide, putative [Cordy... 85 2e-14 gb|KKO96828.1| hypothetical protein THAR02_11067 [Trichoderma ha... 84 3e-14 gb|KIK08719.1| hypothetical protein K443DRAFT_672246 [Laccaria a... 84 3e-14 gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys c... 84 3e-14 gb|EXM12826.1| plasma membrane proteolipid 3 [Fusarium oxysporum... 84 3e-14 >ref|XP_008083600.1| hypothetical protein GLAREA_00651 [Glarea lozoyensis ATCC 20868] gi|361132095|gb|EHL03710.1| putative Plasma membrane proteolipid 3 [Glarea lozoyensis 74030] gi|512200659|gb|EPE29491.1| hypothetical protein GLAREA_00651 [Glarea lozoyensis ATCC 20868] Length = 57 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKII+A+ LPP+GVFLE GCG DLCINILLTILGYIPG Sbjct: 1 MPFTASDICKIILAIFLPPVGVFLERGCGADLCINILLTILGYIPG 46 >ref|XP_001547873.1| conserved hypothetical protein [Botrytis cinerea B05.10] gi|347835463|emb|CCD50035.1| similar to stress response RCI peptide [Botrytis cinerea T4] Length = 57 Score = 87.4 bits (215), Expect = 3e-15 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKII+AV+LPPLGVFLE GCG DL INILLTILGYIPG Sbjct: 1 MPFTASDICKIILAVILPPLGVFLERGCGADLLINILLTILGYIPG 46 >ref|XP_009226059.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] gi|402077736|gb|EJT73085.1| plasma membrane proteolipid 3 [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 83 Score = 87.0 bits (214), Expect = 4e-15 Identities = 41/52 (78%), Positives = 45/52 (86%) Frame = -2 Query: 156 TKHTAAMPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 T A MPFTASDICKII+AV+LPPLGVFLE GCG DL INILLT+LGY+PG Sbjct: 21 TDTPANMPFTASDICKIILAVILPPLGVFLERGCGADLLINILLTLLGYLPG 72 >ref|XP_001588788.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980] gi|154694724|gb|EDN94462.1| hypothetical protein SS1G_10335 [Sclerotinia sclerotiorum 1980 UF-70] Length = 57 Score = 87.0 bits (214), Expect = 4e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKII+A++LPPLGVFLE GCG DL INILLTILGYIPG Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCGADLLINILLTILGYIPG 46 >ref|XP_003719726.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|351639495|gb|EHA47359.1| plasma membrane proteolipid 3 [Magnaporthe oryzae 70-15] gi|440472934|gb|ELQ41764.1| hypothetical protein OOU_Y34scaffold00255g62 [Magnaporthe oryzae Y34] gi|440478702|gb|ELQ59512.1| hypothetical protein OOW_P131scaffold01349g18 [Magnaporthe oryzae P131] Length = 57 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKII+AV+LPPLGVF+E GCG DL INILLTILGYIPG Sbjct: 1 MPFTASDICKIILAVILPPLGVFMERGCGADLLINILLTILGYIPG 46 >emb|CCA68482.1| probable RIC1 protein [Piriformospora indica DSM 11827] Length = 57 Score = 85.9 bits (211), Expect = 1e-14 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDI KII+A+LLPPLGVFLE GCGGDL INILLTILGYIPG Sbjct: 1 MPFTASDIFKIILAILLPPLGVFLERGCGGDLVINILLTILGYIPG 46 >emb|CEJ91660.1| Putative Plasma membrane proteolipid 3 [Torrubiella hemipterigena] Length = 57 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFT SDICKI++A++LPP+GV LE GCG DLCINILLTILGYIPG Sbjct: 1 MPFTTSDICKILLAIILPPIGVLLERGCGADLCINILLTILGYIPG 46 >gb|ERS97669.1| plasma membrane proteolipid 3 [Sporothrix schenckii ATCC 58251] gi|780591434|gb|KJR82193.1| hypothetical protein SPSK_10959 [Sporothrix schenckii 1099-18] Length = 57 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFT SDICKII+A++LPPLGVFLE GCG DL INILLTILGYIPG Sbjct: 1 MPFTTSDICKIILAIILPPLGVFLERGCGADLLINILLTILGYIPG 46 >gb|EHK25550.1| hypothetical protein TRIVIDRAFT_72673 [Trichoderma virens Gv29-8] Length = 57 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKI++A++LPP+GVFLE GCG DL INILLTILGYIPG Sbjct: 1 MPFTASDICKILLAIILPPIGVFLERGCGADLLINILLTILGYIPG 46 >ref|XP_001875355.1| predicted protein [Laccaria bicolor S238N-H82] gi|164650555|gb|EDR14796.1| predicted protein [Laccaria bicolor S238N-H82] Length = 57 Score = 85.5 bits (210), Expect = 1e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKI++A+ +PPLGVFLE GCG DL INILLTILGYIPG Sbjct: 1 MPFTASDICKILIAIFIPPLGVFLERGCGADLLINILLTILGYIPG 46 >gb|KFY70616.1| hypothetical protein V498_10298, partial [Pseudogymnoascus pannorum VKM F-4517 (FW-2822)] Length = 143 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/46 (84%), Positives = 41/46 (89%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 M FTASDICKII A+ LPP+GVFLE GCG DLCINILLTILGYIPG Sbjct: 1 MAFTASDICKIIFAIFLPPVGVFLERGCGADLCINILLTILGYIPG 46 >ref|XP_003009000.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] gi|261352146|gb|EEY14574.1| conserved hypothetical protein [Verticillium alfalfae VaMs.102] Length = 57 Score = 85.1 bits (209), Expect = 2e-14 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKI++A++LPP+GVFLE GCG DL INILLTILGYIPG Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADLLINILLTILGYIPG 46 >ref|XP_008601865.1| plasma membrane proteolipid 3 [Beauveria bassiana ARSEF 2860] gi|400594624|gb|EJP62462.1| plasma membrane proteolipid 3 [Beauveria bassiana ARSEF 2860] Length = 57 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKI++A++LPP+GV LE GCG DLCINI LTILGYIPG Sbjct: 1 MPFTASDICKILLAIILPPIGVLLERGCGADLCINICLTILGYIPG 46 >ref|XP_001910957.1| hypothetical protein [Podospora anserina S mat+] gi|170945981|emb|CAP72782.1| unnamed protein product [Podospora anserina S mat+] gi|681095051|emb|CDP25180.1| Putative plasma membrane proteolipid 3 [Podospora anserina S mat+] Length = 57 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/46 (86%), Positives = 41/46 (89%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFT SDICKII AVLLPPLGVFLE GCG DL IN+LLTILGYIPG Sbjct: 1 MPFTGSDICKIIFAVLLPPLGVFLERGCGADLLINLLLTILGYIPG 46 >ref|XP_001539523.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] gi|150413108|gb|EDN08491.1| conserved hypothetical protein [Histoplasma capsulatum NAm1] gi|225561169|gb|EEH09450.1| plasma membrane proteolipid 3 [Histoplasma capsulatum G186AR] gi|240280247|gb|EER43751.1| plasma membrane proteolipid 3 [Histoplasma capsulatum H143] gi|325096659|gb|EGC49969.1| plasma membrane proteolipid 3 [Histoplasma capsulatum H88] Length = 57 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKII+A++LPPLGVFLE GCG DL INI LTILGYIPG Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCGADLLINICLTILGYIPG 46 >ref|XP_006665500.1| stress response RCI peptide, putative [Cordyceps militaris CM01] gi|346326027|gb|EGX95623.1| stress response RCI peptide, putative [Cordyceps militaris CM01] Length = 57 Score = 84.7 bits (208), Expect = 2e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKI++A++LPP+GV LE GCG DLCINI LTILGYIPG Sbjct: 1 MPFTASDICKILLAIILPPVGVLLERGCGADLCINICLTILGYIPG 46 >gb|KKO96828.1| hypothetical protein THAR02_11067 [Trichoderma harzianum] Length = 57 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKII+A++LPP+GVFLE GCG DL INILLTILGY PG Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADLLINILLTILGYFPG 46 >gb|KIK08719.1| hypothetical protein K443DRAFT_672246 [Laccaria amethystina LaAM-08-1] Length = 57 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFT SDICKI+VA+ +PPLGVFLE GCG DL INILLTILGYIPG Sbjct: 1 MPFTTSDICKILVAIFIPPLGVFLERGCGADLLINILLTILGYIPG 46 >gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys chlorohalonata IBT 40285] Length = 57 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKII+AVLLPP+GVFLE GCG D INILLTILGY+PG Sbjct: 1 MPFTASDICKIILAVLLPPVGVFLERGCGADFFINILLTILGYLPG 46 >gb|EXM12826.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 57 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -2 Query: 138 MPFTASDICKIIVAVLLPPLGVFLETGCGGDLCINILLTILGYIPG 1 MPFTASDICKI++A++LPP+GVFLE GCG DL INILLTILGYIPG Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGTDLLINILLTILGYIPG 46