BLASTX nr result
ID: Anemarrhena21_contig00067501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00067501 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB09779.1| hypothetical protein B456_001G164700, partial [Go... 60 4e-07 >gb|KJB09779.1| hypothetical protein B456_001G164700, partial [Gossypium raimondii] Length = 231 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/40 (75%), Positives = 30/40 (75%) Frame = +3 Query: 90 NKWER*DSYLHRKYSIYLQFVAFDHSATLPFPGRHALQWV 209 NKWER DS L RK S LQ VAFDHSATLPFPGR QWV Sbjct: 185 NKWERQDSNLRRKTSTDLQSVAFDHSATLPFPGRGPPQWV 224