BLASTX nr result
ID: Anemarrhena21_contig00067372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00067372 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009404734.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 >ref|XP_009404734.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 [Musa acuminata subsp. malaccensis] gi|695034493|ref|XP_009404735.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50990 [Musa acuminata subsp. malaccensis] Length = 559 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/77 (41%), Positives = 46/77 (59%), Gaps = 3/77 (3%) Frame = +2 Query: 2 VLFRSFRPDARTFSLVLKASQLSTSFETALQAHARYIKTGYKLDPA---PLFHFYLQFNL 172 +L FRPD TF+L+L A S++ +TA++AHAR +K G + PLFH YL+ + Sbjct: 47 LLSTPFRPDRWTFALILTACLRSSNLDTAMEAHARVVKHGIMTGASVATPLFHLYLKHDR 106 Query: 173 LSETRQLFDESLRFKTD 223 ++E L DE L K D Sbjct: 107 VAEALLLLDEMLDEKVD 123