BLASTX nr result
ID: Anemarrhena21_contig00067297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00067297 (236 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007788156.1| putative glycoside hydrolase family 17 prote... 84 5e-14 gb|KFH41588.1| glucan endo-1,3-beta-glucosidase-like protein [Ac... 83 6e-14 gb|KFA61796.1| hypothetical protein S40285_05596 [Stachybotrys c... 83 8e-14 gb|KFA47520.1| hypothetical protein S40293_02091 [Stachybotrys c... 83 8e-14 gb|KEY65250.1| hypothetical protein S7711_01770 [Stachybotrys ch... 83 8e-14 gb|KJZ74283.1| hypothetical protein HIM_06289 [Hirsutella minnes... 82 1e-13 gb|ENH77510.1| endo-beta-glucanase [Colletotrichum orbiculare MA... 80 4e-13 ref|XP_003659769.1| glycoside hydrolase family 17 protein [Mycel... 80 5e-13 gb|KKF92616.1| Glucan endo-1 3-beta-glucosidase btgC [Ceratocyst... 79 1e-12 ref|XP_007708491.1| glycoside hydrolase family 17 protein [Bipol... 79 1e-12 gb|KDN68612.1| putative endo-beta-1,3-glucanase [Colletotrichum ... 79 2e-12 gb|EQK99196.1| Glycoside hydrolase, superfamily [Ophiocordyceps ... 79 2e-12 emb|CEJ89589.1| hypothetical protein VHEMI05426 [Torrubiella hem... 78 2e-12 ref|XP_008029252.1| glycoside hydrolase family 17 protein [Setos... 78 2e-12 gb|KHN94402.1| Glycoside hydrolase, superfamily [Metarhizium alb... 77 3e-12 ref|XP_007806636.1| cell wall glucanase, putative [Metarhizium a... 77 3e-12 ref|XP_002844730.1| endo-beta-1,3-glucanase [Arthroderma otae CB... 77 3e-12 gb|KJK74783.1| hypothetical protein H634G_09827 [Metarhizium ani... 77 5e-12 gb|KID97468.1| Glycoside hydrolase, superfamily, partial [Metarh... 77 5e-12 gb|KID86666.1| Glycoside hydrolase, superfamily [Metarhizium gui... 77 5e-12 >ref|XP_007788156.1| putative glycoside hydrolase family 17 protein [Eutypa lata UCREL1] gi|471575103|gb|EMR72749.1| putative glycoside hydrolase family 17 protein [Eutypa lata UCREL1] Length = 545 Score = 83.6 bits (205), Expect = 5e-14 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKTAS 116 WK+RFNEDGKEWED+WG+MDV+R LKDG+KIPDCGGKT S Sbjct: 506 WKIRFNEDGKEWEDQWGIMDVNRKLKDGVKIPDCGGKTVS 545 >gb|KFH41588.1| glucan endo-1,3-beta-glucosidase-like protein [Acremonium chrysogenum ATCC 11550] Length = 695 Score = 83.2 bits (204), Expect = 6e-14 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKTAS 116 WKVRFNE GKEWEDKWGLMDV+RNLK G+KIPDCGGKT S Sbjct: 656 WKVRFNEKGKEWEDKWGLMDVNRNLKKGVKIPDCGGKTVS 695 >gb|KFA61796.1| hypothetical protein S40285_05596 [Stachybotrys chlorohalonata IBT 40285] Length = 703 Score = 82.8 bits (203), Expect = 8e-14 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WK+RFNEDGKEWEDKWGLMDV+RNLKDG+ IPDCGG+T Sbjct: 664 WKIRFNEDGKEWEDKWGLMDVNRNLKDGVVIPDCGGRT 701 >gb|KFA47520.1| hypothetical protein S40293_02091 [Stachybotrys chartarum IBT 40293] Length = 703 Score = 82.8 bits (203), Expect = 8e-14 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WK+RFNEDGKEWEDKWGLMDV+RNLKDG+ IPDCGG+T Sbjct: 664 WKIRFNEDGKEWEDKWGLMDVNRNLKDGVVIPDCGGRT 701 >gb|KEY65250.1| hypothetical protein S7711_01770 [Stachybotrys chartarum IBT 7711] gi|667733844|gb|KFA73273.1| hypothetical protein S40288_07260 [Stachybotrys chartarum IBT 40288] Length = 703 Score = 82.8 bits (203), Expect = 8e-14 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WK+RFNEDGKEWEDKWGLMDV+RNLKDG+ IPDCGG+T Sbjct: 664 WKIRFNEDGKEWEDKWGLMDVNRNLKDGVVIPDCGGRT 701 >gb|KJZ74283.1| hypothetical protein HIM_06289 [Hirsutella minnesotensis 3608] Length = 680 Score = 82.0 bits (201), Expect = 1e-13 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKTAS 116 WKVRFNE GKEWEDKWGLM +DR LKDG+KIPDCGGKT S Sbjct: 641 WKVRFNEKGKEWEDKWGLMGLDRKLKDGIKIPDCGGKTVS 680 >gb|ENH77510.1| endo-beta-glucanase [Colletotrichum orbiculare MAFF 240422] Length = 1193 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/74 (51%), Positives = 49/74 (66%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKTAS*IRTFTHTFRISIYSLAFTA 56 WK+RFNE KEWED+WGLMDV+RNLK G+ IPDCGGKT S R F + +S+ + Sbjct: 702 WKIRFNEKDKEWEDQWGLMDVNRNLKPGVVIPDCGGKTYSSPRRFQDSAEMSVSGARGSL 761 Query: 55 YGIPGAIFLMDAIL 14 + I G+ +D L Sbjct: 762 WFIRGSFARLDCRL 775 >ref|XP_003659769.1| glycoside hydrolase family 17 protein [Myceliophthora thermophila ATCC 42464] gi|347007036|gb|AEO54524.1| glycoside hydrolase family 17 protein [Myceliophthora thermophila ATCC 42464] Length = 768 Score = 80.1 bits (196), Expect = 5e-13 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKTAS 116 WK+RFNE GKEWEDKWGL+ VDR LKDGLKIPDCGGK S Sbjct: 727 WKIRFNEPGKEWEDKWGLLTVDRKLKDGLKIPDCGGKRVS 766 >gb|KKF92616.1| Glucan endo-1 3-beta-glucosidase btgC [Ceratocystis platani] Length = 505 Score = 79.0 bits (193), Expect = 1e-12 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKTAS 116 WKVRFNE+G EWED+WGLMDV+RNLK+G+ IPDCGGKT S Sbjct: 466 WKVRFNEEGAEWEDQWGLMDVNRNLKEGVVIPDCGGKTVS 505 >ref|XP_007708491.1| glycoside hydrolase family 17 protein [Bipolaris zeicola 26-R-13] gi|576923137|gb|EUC37258.1| glycoside hydrolase family 17 protein [Bipolaris zeicola 26-R-13] Length = 614 Score = 79.0 bits (193), Expect = 1e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WK+++NE GKEWEDKWGLMDVDRNLK GLKIPDCGG++ Sbjct: 570 WKIKYNEKGKEWEDKWGLMDVDRNLKPGLKIPDCGGQS 607 >gb|KDN68612.1| putative endo-beta-1,3-glucanase [Colletotrichum sublineola] Length = 738 Score = 78.6 bits (192), Expect = 2e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WK++FNE KEWED+WGLMDVDRNLK G+KIPDCGGKT Sbjct: 700 WKIKFNEKNKEWEDQWGLMDVDRNLKSGVKIPDCGGKT 737 >gb|EQK99196.1| Glycoside hydrolase, superfamily [Ophiocordyceps sinensis CO18] Length = 526 Score = 78.6 bits (192), Expect = 2e-12 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WK+RFNE K WEDKWGLMD+DR LKDG+KIPDCGGKT Sbjct: 488 WKIRFNEKDKNWEDKWGLMDIDRKLKDGVKIPDCGGKT 525 >emb|CEJ89589.1| hypothetical protein VHEMI05426 [Torrubiella hemipterigena] Length = 729 Score = 78.2 bits (191), Expect = 2e-12 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WKVRFNE GKEWED+WG++DV+RNLK G+KIPDCGGKT Sbjct: 691 WKVRFNEPGKEWEDQWGILDVNRNLKKGVKIPDCGGKT 728 >ref|XP_008029252.1| glycoside hydrolase family 17 protein [Setosphaeria turcica Et28A] gi|482806505|gb|EOA83578.1| glycoside hydrolase family 17 protein [Setosphaeria turcica Et28A] Length = 541 Score = 78.2 bits (191), Expect = 2e-12 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGK 125 WK+++NE GKEWEDKWGLMDVDRNLK GLKIPDCGG+ Sbjct: 497 WKIQYNEKGKEWEDKWGLMDVDRNLKPGLKIPDCGGQ 533 >gb|KHN94402.1| Glycoside hydrolase, superfamily [Metarhizium album ARSEF 1941] Length = 714 Score = 77.4 bits (189), Expect = 3e-12 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WK+RFNE GKEWED+WGLMDV+R LK G+KIPDCGGKT Sbjct: 676 WKIRFNEAGKEWEDQWGLMDVNRKLKSGVKIPDCGGKT 713 >ref|XP_007806636.1| cell wall glucanase, putative [Metarhizium acridum CQMa 102] gi|322702057|gb|EFY93805.1| cell wall glucanase, putative [Metarhizium acridum CQMa 102] Length = 718 Score = 77.4 bits (189), Expect = 3e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WKVRFNE KEWEDKWGLMDV+R LK G+KIPDCGGKT Sbjct: 680 WKVRFNEKDKEWEDKWGLMDVNRKLKSGIKIPDCGGKT 717 >ref|XP_002844730.1| endo-beta-1,3-glucanase [Arthroderma otae CBS 113480] gi|238844213|gb|EEQ33875.1| endo-beta-1,3-glucanase [Arthroderma otae CBS 113480] Length = 678 Score = 77.4 bits (189), Expect = 3e-12 Identities = 33/38 (86%), Positives = 33/38 (86%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WKV FNE GKEWEDKWGLMD RNLK GLKIPDCGGKT Sbjct: 639 WKVSFNEPGKEWEDKWGLMDPGRNLKPGLKIPDCGGKT 676 >gb|KJK74783.1| hypothetical protein H634G_09827 [Metarhizium anisopliae BRIP 53293] gi|770400944|gb|KJK86119.1| hypothetical protein H633G_10039 [Metarhizium anisopliae BRIP 53284] Length = 719 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WKVRFNE KEWEDKWGLMDV+R LK G+KIPDCGGKT Sbjct: 681 WKVRFNEKDKEWEDKWGLMDVNRKLKSGVKIPDCGGKT 718 >gb|KID97468.1| Glycoside hydrolase, superfamily, partial [Metarhizium majus ARSEF 297] Length = 723 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WKVRFNE KEWEDKWGLMDV+R LK G+KIPDCGGKT Sbjct: 685 WKVRFNEKDKEWEDKWGLMDVNRKLKSGVKIPDCGGKT 722 >gb|KID86666.1| Glycoside hydrolase, superfamily [Metarhizium guizhouense ARSEF 977] Length = 720 Score = 77.0 bits (188), Expect = 5e-12 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -2 Query: 235 WKVRFNEDGKEWEDKWGLMDVDRNLKDGLKIPDCGGKT 122 WKVRFNE KEWEDKWGLMDV+R LK G+KIPDCGGKT Sbjct: 682 WKVRFNEKDKEWEDKWGLMDVNRKLKSGVKIPDCGGKT 719