BLASTX nr result
ID: Anemarrhena21_contig00064629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064629 (354 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001799928.1| hypothetical protein SNOG_09639 [Phaeosphaer... 68 2e-09 ref|XP_001941976.1| predicted protein [Pyrenophora tritici-repen... 60 6e-07 ref|XP_003302742.1| hypothetical protein PTT_14678 [Pyrenophora ... 57 5e-06 >ref|XP_001799928.1| hypothetical protein SNOG_09639 [Phaeosphaeria nodorum SN15] gi|111061784|gb|EAT82904.1| hypothetical protein SNOG_09639 [Phaeosphaeria nodorum SN15] Length = 753 Score = 68.2 bits (165), Expect = 2e-09 Identities = 36/74 (48%), Positives = 42/74 (56%) Frame = -2 Query: 224 IELTIAYSPYTSSPVQLRIGPEATVYYVSHDLLQNRDWIASSDSSSFAYRWRDHIHLPDV 45 I+ + PY V LRIGP Y+VS LLQN+ WI SS R I LPD+ Sbjct: 17 IQQGVFLRPYIVESVTLRIGPARKRYFVSSSLLQNQAWIESS---------RSRIELPDI 67 Query: 44 DEVTGHVLAHYLYT 3 DE TGH+L HYLYT Sbjct: 68 DENTGHILVHYLYT 81 >ref|XP_001941976.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978069|gb|EDU44695.1| predicted protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 441 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/68 (45%), Positives = 37/68 (54%) Frame = -2 Query: 206 YSPYTSSPVQLRIGPEATVYYVSHDLLQNRDWIASSDSSSFAYRWRDHIHLPDVDEVTGH 27 +SPYT +PV L IG E TVYYV LL R D ++LPD++ TGH Sbjct: 56 FSPYTEAPVALHIGEEPTVYYVPSHLLPR---------GKIHTRGEDPLYLPDIEVETGH 106 Query: 26 VLAHYLYT 3 L HYLYT Sbjct: 107 TLVHYLYT 114 >ref|XP_003302742.1| hypothetical protein PTT_14678 [Pyrenophora teres f. teres 0-1] gi|311321673|gb|EFQ89137.1| hypothetical protein PTT_14678 [Pyrenophora teres f. teres 0-1] Length = 473 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/66 (48%), Positives = 34/66 (51%) Frame = -2 Query: 203 SPYTSSPVQLRIGPEATVYYVSHDLLQNRDWIASSDSSSFAYRWRDHIHLPDVDEVTGHV 24 SPYT +PV L IG E TVYYV LL R D + LPDVD TGH Sbjct: 64 SPYTEAPVALHIGGEPTVYYVPSHLLPR---------GRIHTRGEDPVCLPDVDAETGHT 114 Query: 23 LAHYLY 6 L HYLY Sbjct: 115 LVHYLY 120