BLASTX nr result
ID: Anemarrhena21_contig00063885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063885 (208 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUN21219.1| hypothetical protein COCVIDRAFT_20847 [Bipolaris ... 71 2e-10 ref|XP_007686643.1| hypothetical protein COCMIDRAFT_91694 [Bipol... 71 2e-10 ref|XP_008021159.1| hypothetical protein SETTUDRAFT_170917 [Seto... 71 2e-10 gb|ENI02925.1| hypothetical protein COCC4DRAFT_174198 [Bipolaris... 71 2e-10 gb|EMD97678.1| hypothetical protein COCHEDRAFT_1164816 [Bipolari... 71 2e-10 ref|XP_007704274.1| hypothetical protein COCSADRAFT_247672 [Bipo... 71 2e-10 ref|XP_001934528.1| conserved hypothetical protein [Pyrenophora ... 69 9e-10 ref|XP_001795816.1| hypothetical protein SNOG_05410 [Phaeosphaer... 68 3e-09 ref|XP_007711232.1| hypothetical protein COCCADRAFT_25433 [Bipol... 67 4e-09 ref|XP_003298938.1| hypothetical protein PTT_09811 [Pyrenophora ... 66 8e-09 ref|XP_007778184.1| hypothetical protein W97_02092 [Coniosporium... 64 4e-08 ref|XP_003835165.1| hypothetical protein LEMA_P045060.1 [Leptosp... 60 7e-07 gb|EKG21884.1| Single-stranded nucleic acid binding R3H [Macroph... 58 2e-06 >gb|EUN21219.1| hypothetical protein COCVIDRAFT_20847 [Bipolaris victoriae FI3] Length = 818 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 YNGKPNRNQHPIPGS+NR QFNPQ+QAF+PG RN Sbjct: 662 YNGKPNRNQHPIPGSYNRGQFNPQTQAFVPGGRN 695 >ref|XP_007686643.1| hypothetical protein COCMIDRAFT_91694 [Bipolaris oryzae ATCC 44560] gi|576933282|gb|EUC46810.1| hypothetical protein COCMIDRAFT_91694 [Bipolaris oryzae ATCC 44560] Length = 831 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 YNGKPNRNQHPIPGS+NR QFNPQ+QAF+PG RN Sbjct: 675 YNGKPNRNQHPIPGSYNRGQFNPQTQAFVPGGRN 708 >ref|XP_008021159.1| hypothetical protein SETTUDRAFT_170917 [Setosphaeria turcica Et28A] gi|482815638|gb|EOA92313.1| hypothetical protein SETTUDRAFT_170917 [Setosphaeria turcica Et28A] Length = 849 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 YNGKPNRNQHPIPGS+NR QFNPQ+QAF+PG RN Sbjct: 676 YNGKPNRNQHPIPGSYNRGQFNPQTQAFVPGGRN 709 >gb|ENI02925.1| hypothetical protein COCC4DRAFT_174198 [Bipolaris maydis ATCC 48331] Length = 816 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 YNGKPNRNQHPIPGS+NR QFNPQ+QAF+PG RN Sbjct: 658 YNGKPNRNQHPIPGSYNRGQFNPQTQAFVPGGRN 691 >gb|EMD97678.1| hypothetical protein COCHEDRAFT_1164816 [Bipolaris maydis C5] Length = 736 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 YNGKPNRNQHPIPGS+NR QFNPQ+QAF+PG RN Sbjct: 578 YNGKPNRNQHPIPGSYNRGQFNPQTQAFVPGGRN 611 >ref|XP_007704274.1| hypothetical protein COCSADRAFT_247672 [Bipolaris sorokiniana ND90Pr] gi|451846714|gb|EMD60023.1| hypothetical protein COCSADRAFT_247672 [Bipolaris sorokiniana ND90Pr] Length = 837 Score = 71.2 bits (173), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 YNGKPNRNQHPIPGS+NR QFNPQ+QAF+PG RN Sbjct: 681 YNGKPNRNQHPIPGSYNRGQFNPQTQAFVPGGRN 714 >ref|XP_001934528.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980407|gb|EDU47033.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 784 Score = 69.3 bits (168), Expect = 9e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 +NGKPNRNQHP+PGS+NR QFNPQ+QAFIPG RN Sbjct: 623 FNGKPNRNQHPLPGSYNRGQFNPQTQAFIPGGRN 656 >ref|XP_001795816.1| hypothetical protein SNOG_05410 [Phaeosphaeria nodorum SN15] gi|160706644|gb|EAT87801.2| hypothetical protein SNOG_05410 [Phaeosphaeria nodorum SN15] Length = 812 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 204 PYNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRNPSY 91 PYNG+PN NQHPIPGS+NR QFNPQSQ FIPG + Y Sbjct: 681 PYNGRPNHNQHPIPGSYNRPQFNPQSQTFIPGGPHIPY 718 >ref|XP_007711232.1| hypothetical protein COCCADRAFT_25433 [Bipolaris zeicola 26-R-13] gi|576920301|gb|EUC34460.1| hypothetical protein COCCADRAFT_25433 [Bipolaris zeicola 26-R-13] Length = 818 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 YNGK NRNQHPIPGS+NR QFNPQ+QAF+PG RN Sbjct: 662 YNGKLNRNQHPIPGSYNRGQFNPQTQAFVPGGRN 695 >ref|XP_003298938.1| hypothetical protein PTT_09811 [Pyrenophora teres f. teres 0-1] gi|311327587|gb|EFQ92946.1| hypothetical protein PTT_09811 [Pyrenophora teres f. teres 0-1] Length = 907 Score = 66.2 bits (160), Expect = 8e-09 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRN 100 +NGK NRNQHP+PGS+NR QFNPQ+QAFIPG RN Sbjct: 674 FNGKSNRNQHPLPGSYNRGQFNPQTQAFIPGGRN 707 >ref|XP_007778184.1| hypothetical protein W97_02092 [Coniosporium apollinis CBS 100218] gi|494825713|gb|EON62867.1| hypothetical protein W97_02092 [Coniosporium apollinis CBS 100218] Length = 828 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/37 (81%), Positives = 33/37 (89%), Gaps = 2/37 (5%) Frame = -2 Query: 207 SPY-NGKPNRN-QHPIPGSFNRQQFNPQSQAFIPGSR 103 SPY NGKP RN QHP+PGS+NRQQFNPQSQAF+PG R Sbjct: 627 SPYQNGKPPRNSQHPLPGSYNRQQFNPQSQAFVPGGR 663 >ref|XP_003835165.1| hypothetical protein LEMA_P045060.1 [Leptosphaeria maculans JN3] gi|312211716|emb|CBX91800.1| hypothetical protein LEMA_P045060.1 [Leptosphaeria maculans JN3] Length = 827 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/37 (70%), Positives = 30/37 (81%) Frame = -2 Query: 201 YNGKPNRNQHPIPGSFNRQQFNPQSQAFIPGSRNPSY 91 YNGKPNRNQHP+PGS+ R QFNP +Q+FIP PSY Sbjct: 665 YNGKPNRNQHPVPGSYTRPQFNPATQSFIPHG-VPSY 700 >gb|EKG21884.1| Single-stranded nucleic acid binding R3H [Macrophomina phaseolina MS6] Length = 839 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 186 NRNQHPIPGSFNRQQFNPQSQAFIPGSRNP 97 NRNQHP+PGSFNRQQFNPQSQAF+P P Sbjct: 648 NRNQHPLPGSFNRQQFNPQSQAFVPSFPGP 677