BLASTX nr result
ID: Anemarrhena21_contig00063475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063475 (246 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63162.1| RNase H family protein [Asparagus officinalis] 67 5e-09 >gb|ABD63162.1| RNase H family protein [Asparagus officinalis] Length = 1189 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/57 (59%), Positives = 38/57 (66%), Gaps = 7/57 (12%) Frame = -3 Query: 178 EVNTISMTFEPRDW*FPIIDYVLHSILPDDPKEPTSIKRRLLHFYH-------YRKS 29 EV T SM FE RDW FP IDY ++ ILPDDPKE SIKR+ L FY+ YRKS Sbjct: 792 EVCTTSMEFESRDWRFPYIDYAVYGILPDDPKEAASIKRKALRFYYDAVSQVLYRKS 848