BLASTX nr result
ID: Anemarrhena21_contig00062382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062382 (330 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008797498.1| PREDICTED: putative F-box/LRR-repeat protein... 62 1e-07 ref|XP_010926599.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g... 62 2e-07 >ref|XP_008797498.1| PREDICTED: putative F-box/LRR-repeat protein At3g28410 [Phoenix dactylifera] Length = 457 Score = 62.4 bits (150), Expect = 1e-07 Identities = 38/82 (46%), Positives = 46/82 (56%), Gaps = 1/82 (1%) Frame = -1 Query: 246 FLSFTGSKSPL-LPSCLLTCESLETLHAAGCRLPKFPLPTNWSTLSNLKQLTLNQIKLTD 70 F SF G+ +P LP L CESL L+ CR P+ PLP+ T NL+ LTL LTD Sbjct: 139 FASFFGAPTPHPLPPSLFRCESLRKLNLGNCRFPEPPLPS--PTFPNLRDLTLRFAFLTD 196 Query: 69 FVVSYLLSNSRVLDQLDLLECS 4 ++ LLSN L L LL CS Sbjct: 197 GAITNLLSNCPALQSLALLRCS 218 >ref|XP_010926599.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Elaeis guineensis] gi|743758409|ref|XP_010926607.1| PREDICTED: F-box/FBD/LRR-repeat protein At1g13570-like [Elaeis guineensis] Length = 458 Score = 61.6 bits (148), Expect = 2e-07 Identities = 37/82 (45%), Positives = 46/82 (56%), Gaps = 1/82 (1%) Frame = -1 Query: 246 FLSFTGSKSP-LLPSCLLTCESLETLHAAGCRLPKFPLPTNWSTLSNLKQLTLNQIKLTD 70 F+ F G P LPS LL CESL L+ CR P+ LP+ T NL+ LTL LT+ Sbjct: 139 FVCFFGDPEPHFLPSSLLRCESLRKLNLGNCRFPRSRLPS--PTFPNLRDLTLRLASLTN 196 Query: 69 FVVSYLLSNSRVLDQLDLLECS 4 ++ LLSN R L L LL C+ Sbjct: 197 GDITDLLSNCRALQSLALLGCT 218