BLASTX nr result
ID: Anemarrhena21_contig00062334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062334 (410 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003305785.1| hypothetical protein PTT_18723 [Pyrenophora ... 63 7e-08 ref|XP_001932581.1| hypothetical protein PTRG_02248 [Pyrenophora... 62 2e-07 ref|XP_007682205.1| hypothetical protein COCMIDRAFT_79628 [Bipol... 56 8e-06 >ref|XP_003305785.1| hypothetical protein PTT_18723 [Pyrenophora teres f. teres 0-1] gi|311317043|gb|EFQ86116.1| hypothetical protein PTT_18723 [Pyrenophora teres f. teres 0-1] Length = 225 Score = 63.2 bits (152), Expect = 7e-08 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 9/59 (15%) Frame = -1 Query: 410 REPSPDLFTVDESEEEDVPQLRRKQTLKSKKAKDGASR---------RSKIEVAEKSRL 261 REPSPDLFTVDESEEE++P LRR K++K KDGA R R++++VAEKSRL Sbjct: 170 REPSPDLFTVDESEEEELPVLRRP---KTRKPKDGAERRRSSTRSKSRARVDVAEKSRL 225 >ref|XP_001932581.1| hypothetical protein PTRG_02248 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187974187|gb|EDU41686.1| hypothetical protein PTRG_02248 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 225 Score = 61.6 bits (148), Expect = 2e-07 Identities = 34/59 (57%), Positives = 43/59 (72%), Gaps = 9/59 (15%) Frame = -1 Query: 410 REPSPDLFTVDESEEEDVPQLRRKQTLKSKKAKDGASR---------RSKIEVAEKSRL 261 REPSPDLFTVDESEEE++P LRR K++K K+GA R R++++VAEKSRL Sbjct: 170 REPSPDLFTVDESEEEELPVLRRP---KTRKPKEGAERRRSSTRSKSRARVDVAEKSRL 225 >ref|XP_007682205.1| hypothetical protein COCMIDRAFT_79628 [Bipolaris oryzae ATCC 44560] gi|576937794|gb|EUC51280.1| hypothetical protein COCMIDRAFT_79628 [Bipolaris oryzae ATCC 44560] Length = 222 Score = 56.2 bits (134), Expect = 8e-06 Identities = 32/49 (65%), Positives = 36/49 (73%) Frame = -1 Query: 410 REPSPDLFTVDESEEEDVPQLRRKQTLKSKKAKDGASRRSKIEVAEKSR 264 REPSPDLFTVDESEEE+ P LRR K++KAKDGA RR + KSR Sbjct: 167 REPSPDLFTVDESEEEEGPILRRP---KTRKAKDGAERR-RSSTRSKSR 211