BLASTX nr result
ID: Anemarrhena21_contig00062287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062287 (358 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007685045.1| hypothetical protein COCMIDRAFT_87475, parti... 81 3e-13 ref|XP_001936717.1| conserved hypothetical protein [Pyrenophora ... 81 3e-13 gb|KIW48209.1| 60S ribosomal protein L29 [Exophiala oligosperma] 79 1e-12 ref|XP_003841913.1| hypothetical protein LEMA_P098430.1 [Leptosp... 78 3e-12 dbj|GAM89296.1| hypothetical protein ANO11243_073330 [fungal sp.... 75 1e-11 gb|EEH16090.2| 60S ribosomal protein L29 [Paracoccidioides brasi... 75 1e-11 ref|XP_010763039.1| 60S ribosomal protein L29 [Paracoccidioides ... 75 1e-11 gb|EEH11222.1| conserved hypothetical protein [Histoplasma capsu... 75 1e-11 ref|XP_001229506.1| 60S ribosomal protein L29 [Chaetomium globos... 75 1e-11 ref|XP_007832045.1| 60S ribosomal protein L29 [Pestalotiopsis fi... 75 1e-11 gb|ETR96974.1| ribosomal L29e family protein [Trichoderma reesei... 75 1e-11 gb|EQB58737.1| hypothetical protein CGLO_00978 [Colletotrichum g... 75 1e-11 emb|CCU75680.1| 60S ribosomal protein L29 [Blumeria graminis f. ... 75 1e-11 gb|EPQ63736.1| Protein component of the large (60S) ribosomal su... 75 1e-11 ref|XP_008022597.1| hypothetical protein SETTUDRAFT_167470 [Seto... 75 1e-11 gb|ENH83968.1| 60s ribosomal protein, partial [Colletotrichum or... 75 1e-11 gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistrom... 75 1e-11 ref|XP_003663050.1| hypothetical protein MYCTH_2304441 [Myceliop... 75 1e-11 ref|XP_006969770.1| ribosomal protein L29 [Trichoderma reesei QM... 75 1e-11 gb|EGE05211.1| 60S ribosomal protein L29 [Trichophyton equinum C... 75 1e-11 >ref|XP_007685045.1| hypothetical protein COCMIDRAFT_87475, partial [Bipolaris oryzae ATCC 44560] gi|628060456|ref|XP_007696225.1| hypothetical protein COCSADRAFT_80195, partial [Bipolaris sorokiniana ND90Pr] gi|628181400|ref|XP_007706418.1| hypothetical protein COCCADRAFT_80670, partial [Bipolaris zeicola 26-R-13] gi|451855393|gb|EMD68685.1| hypothetical protein COCSADRAFT_80195, partial [Bipolaris sorokiniana ND90Pr] gi|452004436|gb|EMD96892.1| hypothetical protein COCHEDRAFT_1085190, partial [Bipolaris maydis C5] gi|477586677|gb|ENI03761.1| hypothetical protein COCC4DRAFT_142547, partial [Bipolaris maydis ATCC 48331] gi|576925237|gb|EUC39342.1| hypothetical protein COCCADRAFT_80670, partial [Bipolaris zeicola 26-R-13] gi|576934887|gb|EUC48396.1| hypothetical protein COCMIDRAFT_87475, partial [Bipolaris oryzae ATCC 44560] gi|578494853|gb|EUN32238.1| hypothetical protein COCVIDRAFT_85825, partial [Bipolaris victoriae FI3] Length = 81 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/60 (68%), Positives = 41/60 (68%) Frame = -1 Query: 346 ASPTHNTVAMAXXXXXXXXXXXXXXHRNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 A T TVAMA HRNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 8 AKSTSTTVAMAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 67 >ref|XP_001936717.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983816|gb|EDU49304.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 111 Score = 80.9 bits (198), Expect = 3e-13 Identities = 41/60 (68%), Positives = 41/60 (68%) Frame = -1 Query: 346 ASPTHNTVAMAXXXXXXXXXXXXXXHRNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 A T TVAMA HRNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 38 AKSTSTTVAMAKSKNSSQHNQSKKNHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 97 >gb|KIW48209.1| 60S ribosomal protein L29 [Exophiala oligosperma] Length = 113 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/59 (67%), Positives = 40/59 (67%) Frame = -1 Query: 343 SPTHNTVAMAXXXXXXXXXXXXXXHRNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 S NTV MA HRNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 41 SQVTNTVEMAKSKNSSQHNQAKKAHRNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 99 >ref|XP_003841913.1| hypothetical protein LEMA_P098430.1 [Leptosphaeria maculans JN3] gi|312218488|emb|CBX98434.1| hypothetical protein LEMA_P098430.1 [Leptosphaeria maculans JN3] Length = 119 Score = 77.8 bits (190), Expect = 3e-12 Identities = 48/100 (48%), Positives = 52/100 (52%), Gaps = 12/100 (12%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTMXXXXXXXXXX*FGT*DEMRCGRLSNL 89 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM G + RCG + Sbjct: 18 RNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTMRALVQG------GQGRQARCGINTTT 71 Query: 88 P---------MKHFAASMAYGRFYDGFELIS---GSGFYT 5 M+H YDG EL S GS +T Sbjct: 72 TNERGGFDSFMRHLVGVNGIRTSYDGLELSSAEDGSSTHT 111 >dbj|GAM89296.1| hypothetical protein ANO11243_073330 [fungal sp. No.11243] Length = 56 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTNRYPSLKGTDPKFRRNHRHALHGTM 51 >gb|EEH16090.2| 60S ribosomal protein L29 [Paracoccidioides brasiliensis Pb03] Length = 92 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 45 RNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 78 >ref|XP_010763039.1| 60S ribosomal protein L29 [Paracoccidioides brasiliensis Pb18] gi|699748565|gb|EEH42970.2| 60S ribosomal protein L29 [Paracoccidioides brasiliensis Pb18] Length = 92 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 45 RNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 78 >gb|EEH11222.1| conserved hypothetical protein [Histoplasma capsulatum G186AR] gi|240279767|gb|EER43272.1| conserved hypothetical protein [Histoplasma capsulatum H143] gi|325092897|gb|EGC46207.1| conserved hypothetical protein [Histoplasma capsulatum H88] Length = 65 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 51 >ref|XP_001229506.1| 60S ribosomal protein L29 [Chaetomium globosum CBS 148.51] gi|88183587|gb|EAQ91055.1| 60S ribosomal protein L29 [Chaetomium globosum CBS 148.51] Length = 65 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGT 170 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGT Sbjct: 18 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGT 50 >ref|XP_007832045.1| 60S ribosomal protein L29 [Pestalotiopsis fici W106-1] gi|573063746|gb|ETS83397.1| 60S ribosomal protein L29 [Pestalotiopsis fici W106-1] Length = 65 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTM 51 >gb|ETR96974.1| ribosomal L29e family protein [Trichoderma reesei RUT C-30] Length = 63 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTM 51 >gb|EQB58737.1| hypothetical protein CGLO_00978 [Colletotrichum gloeosporioides Cg-14] Length = 393 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 346 RNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTM 379 >emb|CCU75680.1| 60S ribosomal protein L29 [Blumeria graminis f. sp. hordei DH14] Length = 65 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTM 51 >gb|EPQ63736.1| Protein component of the large (60S) ribosomal subunit, partial [Blumeria graminis f. sp. tritici 96224] Length = 63 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 16 RNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTM 49 >ref|XP_008022597.1| hypothetical protein SETTUDRAFT_167470 [Setosphaeria turcica Et28A] gi|482812914|gb|EOA89618.1| hypothetical protein SETTUDRAFT_167470 [Setosphaeria turcica Et28A] Length = 65 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 51 >gb|ENH83968.1| 60s ribosomal protein, partial [Colletotrichum orbiculare MAFF 240422] Length = 54 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTM 51 >gb|EME39946.1| hypothetical protein DOTSEDRAFT_47443 [Dothistroma septosporum NZE10] Length = 65 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 51 >ref|XP_003663050.1| hypothetical protein MYCTH_2304441 [Myceliophthora thermophila ATCC 42464] gi|347010319|gb|AEO57805.1| hypothetical protein MYCTH_2304441 [Myceliophthora thermophila ATCC 42464] Length = 65 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGT 170 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGT Sbjct: 18 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGT 50 >ref|XP_006969770.1| ribosomal protein L29 [Trichoderma reesei QM6a] gi|340514000|gb|EGR44271.1| ribosomal protein L29, partial [Trichoderma reesei QM6a] Length = 59 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTSRYPSLKGTDPKFRRNHRHALHGTM 51 >gb|EGE05211.1| 60S ribosomal protein L29 [Trichophyton equinum CBS 127.97] Length = 67 Score = 75.5 bits (184), Expect = 1e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -1 Query: 268 RNGIKKPKTQRYPSLKGTDPKFRRNHRHALHGTM 167 RNGIKKPKT RYPSLKGTDPKFRRNHRHALHGTM Sbjct: 18 RNGIKKPKTHRYPSLKGTDPKFRRNHRHALHGTM 51