BLASTX nr result
ID: Anemarrhena21_contig00062144
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062144 (444 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001933227.1| conserved hypothetical protein [Pyrenophora ... 59 1e-06 >ref|XP_001933227.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978791|gb|EDU45417.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 443 Score = 59.3 bits (142), Expect = 1e-06 Identities = 43/113 (38%), Positives = 58/113 (51%), Gaps = 8/113 (7%) Frame = -3 Query: 436 EYQNPQNTRSRSSSVQQPPKLVPFPVTDYQHYTAEXXXXXXXXXXXXXXXXXXXXYARRV 257 E P +R+RS S+Q +LVPFPV YQ+++ RR+ Sbjct: 307 EADTPPVSRTRSPSIQSS-RLVPFPVEPYQYHSFSPASSSSPTSPQLQY-------TRRI 358 Query: 256 VSGPADGNYMTMPRRVPVPV--------QRATAPMSGVQGSFSDPTLPSRSSG 122 SG ++ +Y ++PRRVPVPV QRA A SG QGS SDP L ++ SG Sbjct: 359 SSGVSEASYASIPRRVPVPVQASASIPLQRAVAVGSG-QGSQSDPVLVTQVSG 410