BLASTX nr result
ID: Anemarrhena21_contig00062134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062134 (255 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EUN23733.1| hypothetical protein COCVIDRAFT_29515 [Bipolaris ... 69 2e-09 ref|XP_007688447.1| hypothetical protein COCMIDRAFT_96593 [Bipol... 69 2e-09 ref|XP_007710524.1| hypothetical protein COCCADRAFT_91502 [Bipol... 69 2e-09 ref|XP_007695462.1| hypothetical protein COCSADRAFT_33139 [Bipol... 68 3e-09 gb|EMD93507.1| hypothetical protein COCHEDRAFT_1131913 [Bipolari... 67 6e-09 ref|XP_008020823.1| hypothetical protein SETTUDRAFT_170546 [Seto... 65 2e-08 ref|XP_001796897.1| hypothetical protein SNOG_06530 [Phaeosphaer... 64 5e-08 ref|XP_001932737.1| conserved hypothetical protein [Pyrenophora ... 58 3e-06 ref|XP_003299778.1| hypothetical protein PTT_10837 [Pyrenophora ... 57 6e-06 >gb|EUN23733.1| hypothetical protein COCVIDRAFT_29515 [Bipolaris victoriae FI3] Length = 312 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLELVLSRTANV 100 V+KAVKASLSEPVLFG G AGEDIIRFR+ +EE EKM+ LE+ +RTA V Sbjct: 262 VRKAVKASLSEPVLFGTG-AGEDIIRFREADEEMQEKMKMHLEMAAARTAEV 312 >ref|XP_007688447.1| hypothetical protein COCMIDRAFT_96593 [Bipolaris oryzae ATCC 44560] gi|576931477|gb|EUC45037.1| hypothetical protein COCMIDRAFT_96593 [Bipolaris oryzae ATCC 44560] Length = 311 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLELVLSRTANV 100 V+KAVKASLSEPVLFG G AGEDIIRFR+ +EE EKM+ LE+ +RTA V Sbjct: 261 VRKAVKASLSEPVLFGTG-AGEDIIRFREADEEMQEKMKMHLEMAAARTAEV 311 >ref|XP_007710524.1| hypothetical protein COCCADRAFT_91502 [Bipolaris zeicola 26-R-13] gi|576921019|gb|EUC35166.1| hypothetical protein COCCADRAFT_91502 [Bipolaris zeicola 26-R-13] Length = 312 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLELVLSRTANV 100 V+KAVKASLSEPVLFG G AGEDIIRFR+ +EE EKM+ LE+ +RTA V Sbjct: 262 VRKAVKASLSEPVLFGTG-AGEDIIRFREADEEMQEKMKMHLEMAAARTAEV 312 >ref|XP_007695462.1| hypothetical protein COCSADRAFT_33139 [Bipolaris sorokiniana ND90Pr] gi|451854885|gb|EMD68177.1| hypothetical protein COCSADRAFT_33139 [Bipolaris sorokiniana ND90Pr] Length = 311 Score = 67.8 bits (164), Expect = 3e-09 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLELVLSRTANV 100 V+KAVKASLSEPVLFG G AGEDIIRFR+ +EE EKM+ LE+ +RTA V Sbjct: 261 VRKAVKASLSEPVLFGTG-AGEDIIRFRETDEEMQEKMKMHLEMAAARTAEV 311 >gb|EMD93507.1| hypothetical protein COCHEDRAFT_1131913 [Bipolaris maydis C5] gi|477589970|gb|ENI07045.1| hypothetical protein COCC4DRAFT_191609 [Bipolaris maydis ATCC 48331] Length = 311 Score = 66.6 bits (161), Expect = 6e-09 Identities = 35/52 (67%), Positives = 41/52 (78%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLELVLSRTANV 100 V+KAVKASLSEPVLFG G AGEDIIRFR+ +EE E M+ LE+ +RTA V Sbjct: 261 VRKAVKASLSEPVLFGTG-AGEDIIRFREADEEMQENMKMHLEMAAARTAEV 311 >ref|XP_008020823.1| hypothetical protein SETTUDRAFT_170546 [Setosphaeria turcica Et28A] gi|482815061|gb|EOA91736.1| hypothetical protein SETTUDRAFT_170546 [Setosphaeria turcica Et28A] Length = 311 Score = 65.1 bits (157), Expect = 2e-08 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLELVLSRTANV 100 VKKAVKASLSE VLFG G AGEDIIRFR+ +EE +KM+ L++ +RTA V Sbjct: 261 VKKAVKASLSESVLFGAG-AGEDIIRFREADEEMQDKMKAHLDMAAARTAEV 311 >ref|XP_001796897.1| hypothetical protein SNOG_06530 [Phaeosphaeria nodorum SN15] gi|111065241|gb|EAT86361.1| hypothetical protein SNOG_06530 [Phaeosphaeria nodorum SN15] Length = 306 Score = 63.5 bits (153), Expect = 5e-08 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLE 127 VKKAVKASLSEPVLFG EDIIRFRD +EE+TE+MRRQLE Sbjct: 259 VKKAVKASLSEPVLFGT----EDIIRFRDSDEETTERMRRQLE 297 >ref|XP_001932737.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978301|gb|EDU44927.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 340 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLELVLSRTA 106 V+KAVKASLSEPVL+G +AGEDIIRFR+ +EE EKM+ LE + A Sbjct: 288 VRKAVKASLSEPVLYGT-SAGEDIIRFREADEEMQEKMKWHLETAAAAAA 336 >ref|XP_003299778.1| hypothetical protein PTT_10837 [Pyrenophora teres f. teres 0-1] gi|311326436|gb|EFQ92136.1| hypothetical protein PTT_10837 [Pyrenophora teres f. teres 0-1] Length = 337 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/50 (60%), Positives = 38/50 (76%) Frame = -1 Query: 255 VKKAVKASLSEPVLFGGGTAGEDIIRFRDGEEESTEKMRRQLELVLSRTA 106 V+KAVKASLSEPVL+G +AGEDIIRFR+ +E+ EKM+ LE + A Sbjct: 287 VRKAVKASLSEPVLYGT-SAGEDIIRFREADEDMQEKMKWHLETAAAAAA 335