BLASTX nr result
ID: Anemarrhena21_contig00058724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00058724 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter S... 59 1e-06 ref|XP_009403777.1| PREDICTED: bidirectional sugar transporter S... 59 1e-06 ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter S... 59 1e-06 ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter S... 58 3e-06 ref|XP_009405955.1| PREDICTED: bidirectional sugar transporter S... 57 4e-06 gb|EMT22394.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii] 56 8e-06 dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare] 56 8e-06 >ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis guineensis] gi|743813034|ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis guineensis] Length = 295 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 168 MFGLSTTNHWAFTFGILGNLISFMVYLAPLPTF 266 M GLS + WAFTFGILGN+ISFMVYLAPLPTF Sbjct: 1 MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTF 33 >ref|XP_009403777.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa acuminata subsp. malaccensis] Length = 288 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 168 MFGLSTTNHWAFTFGILGNLISFMVYLAPLPTF 266 M GLS + WAFTFGILGN+ISFMVYLAPLPTF Sbjct: 1 MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTF 33 >ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa acuminata subsp. malaccensis] Length = 281 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +3 Query: 168 MFGLSTTNHWAFTFGILGNLISFMVYLAPLPTF 266 M GLS + WAFTFGILGN+ISFMVYLAPLPTF Sbjct: 1 MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTF 33 >ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix dactylifera] Length = 296 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 168 MFGLSTTNHWAFTFGILGNLISFMVYLAPLPTF 266 M GLS + WAFTFGILGN+ISFMVY+APLPTF Sbjct: 1 MAGLSLDHPWAFTFGILGNIISFMVYVAPLPTF 33 >ref|XP_009405955.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa acuminata subsp. malaccensis] Length = 275 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +3 Query: 174 GLSTTNHWAFTFGILGNLISFMVYLAPLPTF 266 GLS WAFTFGILGN+ISFMVYLAPLPTF Sbjct: 4 GLSLDRPWAFTFGILGNIISFMVYLAPLPTF 34 >gb|EMT22394.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii] Length = 296 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 168 MFGLSTTNHWAFTFGILGNLISFMVYLAPLPTF 266 M GLS + WAFTFG+LGN+ISFM YLAPLPTF Sbjct: 1 MGGLSVQHPWAFTFGLLGNVISFMTYLAPLPTF 33 >dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 292 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 168 MFGLSTTNHWAFTFGILGNLISFMVYLAPLPTF 266 M GLS + WAFTFG+LGN+ISFM YLAPLPTF Sbjct: 1 MGGLSAQHPWAFTFGLLGNVISFMTYLAPLPTF 33