BLASTX nr result
ID: Anemarrhena21_contig00058628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00058628 (407 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008809852.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_008809852.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170 [Phoenix dactylifera] Length = 572 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%) Frame = -2 Query: 334 VFIRILTRIRSQTSIALYFFNLASSNLQFQPDINSIFKLT-LSVEFKIHNESRSVLQSFL 158 +F+ ILTRI+SQ I+L FFN A SNL F PD+ S+ K+ + V+ + + ++ +L L Sbjct: 61 LFLHILTRIQSQPEISLRFFNWAKSNLGFHPDLRSLSKMVQILVDSDLLDPAKHLLHPLL 120 Query: 157 CSEPVLFVLDSVFMGS 110 SEP VLDS+ S Sbjct: 121 RSEPFPAVLDSILRAS 136