BLASTX nr result
ID: Anemarrhena21_contig00055066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00055066 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM93391.1| hypothetical protein AMTR_s05614p00001110, partia... 69 1e-09 >gb|ERM93391.1| hypothetical protein AMTR_s05614p00001110, partial [Amborella trichopoda] Length = 509 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = +2 Query: 5 EAKYTVYGYAPALQYWAYEAIPEFRRNYGSTEGIRVPRMLSWS 133 E KYT YG+APA+QYWAYEAI E + YG+ GIR PRMLSW+ Sbjct: 92 ECKYTAYGFAPAVQYWAYEAILEVGKRYGTNHGIRFPRMLSWT 134