BLASTX nr result
ID: Anemarrhena21_contig00054792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00054792 (267 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008775420.1| PREDICTED: pentatricopeptide repeat-containi... 120 4e-25 ref|XP_010914819.1| PREDICTED: pentatricopeptide repeat-containi... 118 2e-24 ref|XP_009412427.1| PREDICTED: pentatricopeptide repeat-containi... 115 9e-24 ref|XP_002278925.2| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 emb|CBI39683.3| unnamed protein product [Vitis vinifera] 107 4e-21 ref|XP_008359847.1| PREDICTED: pentatricopeptide repeat-containi... 104 2e-20 ref|XP_010256343.1| PREDICTED: pentatricopeptide repeat-containi... 104 3e-20 ref|XP_010094922.1| hypothetical protein L484_022672 [Morus nota... 102 1e-19 ref|XP_011622363.1| PREDICTED: pentatricopeptide repeat-containi... 102 1e-19 ref|XP_004304919.1| PREDICTED: pentatricopeptide repeat-containi... 100 3e-19 ref|XP_009366008.1| PREDICTED: pentatricopeptide repeat-containi... 100 5e-19 ref|XP_010549168.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_011041357.1| PREDICTED: pentatricopeptide repeat-containi... 99 1e-18 ref|XP_008246339.1| PREDICTED: pentatricopeptide repeat-containi... 98 2e-18 ref|XP_002323212.2| pentatricopeptide repeat-containing family p... 98 2e-18 ref|XP_007207191.1| hypothetical protein PRUPE_ppa017094mg [Prun... 97 3e-18 ref|XP_008345659.1| PREDICTED: pentatricopeptide repeat-containi... 97 4e-18 ref|XP_008441882.1| PREDICTED: pentatricopeptide repeat-containi... 96 9e-18 ref|XP_010037930.1| PREDICTED: pentatricopeptide repeat-containi... 95 2e-17 gb|KGN61250.1| hypothetical protein Csa_2G074120 [Cucumis sativus] 94 5e-17 >ref|XP_008775420.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Phoenix dactylifera] Length = 583 Score = 120 bits (301), Expect = 4e-25 Identities = 58/84 (69%), Positives = 71/84 (84%), Gaps = 1/84 (1%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 MCRA +LLTLLQGCNSM+RLR+IHAQV+++G ++P++S KL++FCA STAGDLSYA LL Sbjct: 1 MCRAASLLTLLQGCNSMRRLRRIHAQVIVSGLLRNPTVSAKLIAFCATSTAGDLSYARLL 60 Query: 69 FSLLQDP-HPQDWNSIIRGSSRGP 1 FS L P H WNS+IRGSSRGP Sbjct: 61 FSHLPPPLHLDHWNSLIRGSSRGP 84 >ref|XP_010914819.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Elaeis guineensis] Length = 584 Score = 118 bits (295), Expect = 2e-24 Identities = 58/84 (69%), Positives = 68/84 (80%), Gaps = 1/84 (1%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 MCRA +LLT LQGCNSM+RLRKIHAQV++NG +P++S KLL+FCA S AGDLSY+ LL Sbjct: 1 MCRAASLLTHLQGCNSMRRLRKIHAQVIVNGLLSNPAVSAKLLAFCATSAAGDLSYSRLL 60 Query: 69 FSLLQDP-HPQDWNSIIRGSSRGP 1 FS L P H WNS+IRGSSRGP Sbjct: 61 FSHLPPPLHLDHWNSLIRGSSRGP 84 >ref|XP_009412427.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Musa acuminata subsp. malaccensis] Length = 576 Score = 115 bits (289), Expect = 9e-24 Identities = 56/83 (67%), Positives = 63/83 (75%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 MC A LL LLQGCNSM RLRKIHAQVL+ GY HP++S KLLSFCA S AGDL+YA LL Sbjct: 1 MCGAAKLLRLLQGCNSMDRLRKIHAQVLLQGYHGHPAVSAKLLSFCATSAAGDLAYARLL 60 Query: 69 FSLLQDPHPQDWNSIIRGSSRGP 1 FS + P WN++IRGSSR P Sbjct: 61 FSGILRPTTDHWNALIRGSSRSP 83 >ref|XP_002278925.2| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Vitis vinifera] Length = 603 Score = 107 bits (266), Expect = 4e-21 Identities = 49/83 (59%), Positives = 63/83 (75%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 M A +L+LLQGCNSM++L KIHA +LINGYQ +PSIS KLL+FCAVS +G L+YA L+ Sbjct: 20 MANARAILSLLQGCNSMRKLHKIHAHILINGYQHNPSISEKLLNFCAVSVSGSLAYAQLV 79 Query: 69 FSLLQDPHPQDWNSIIRGSSRGP 1 F + +P WNS+IRG S+ P Sbjct: 80 FHRIHNPQTPAWNSMIRGFSQSP 102 >emb|CBI39683.3| unnamed protein product [Vitis vinifera] Length = 585 Score = 107 bits (266), Expect = 4e-21 Identities = 49/83 (59%), Positives = 63/83 (75%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 M A +L+LLQGCNSM++L KIHA +LINGYQ +PSIS KLL+FCAVS +G L+YA L+ Sbjct: 2 MANARAILSLLQGCNSMRKLHKIHAHILINGYQHNPSISEKLLNFCAVSVSGSLAYAQLV 61 Query: 69 FSLLQDPHPQDWNSIIRGSSRGP 1 F + +P WNS+IRG S+ P Sbjct: 62 FHRIHNPQTPAWNSMIRGFSQSP 84 >ref|XP_008359847.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550-like [Malus domestica] Length = 587 Score = 104 bits (260), Expect = 2e-20 Identities = 50/82 (60%), Positives = 61/82 (74%), Gaps = 1/82 (1%) Frame = -1 Query: 243 RANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLLF- 67 + +L+LLQGCNS+QR +KIHA V+ NG Q HP+IS KLL+FCAVS +G L YA LLF Sbjct: 6 KTKAILSLLQGCNSLQRFKKIHAHVITNGLQPHPAISNKLLNFCAVSVSGSLPYAQLLFH 65 Query: 66 SLLQDPHPQDWNSIIRGSSRGP 1 LQ+P QDWNS+IRG S P Sbjct: 66 HHLQNPQTQDWNSLIRGFSNSP 87 >ref|XP_010256343.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Nelumbo nucifera] Length = 579 Score = 104 bits (259), Expect = 3e-20 Identities = 49/83 (59%), Positives = 63/83 (75%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 M R N +L LLQGCNSM+RL+KI A V++NGYQ +IS KLLSFCA+S +G L+YAHLL Sbjct: 1 MSRINGILNLLQGCNSMKRLQKIQAFVIVNGYQDDLAISNKLLSFCAISVSGSLAYAHLL 60 Query: 69 FSLLQDPHPQDWNSIIRGSSRGP 1 F+ + +P WNS+IRG S+ P Sbjct: 61 FNQINNPDTAAWNSMIRGLSQSP 83 >ref|XP_010094922.1| hypothetical protein L484_022672 [Morus notabilis] gi|587868198|gb|EXB57565.1| hypothetical protein L484_022672 [Morus notabilis] Length = 584 Score = 102 bits (254), Expect = 1e-19 Identities = 51/82 (62%), Positives = 62/82 (75%), Gaps = 1/82 (1%) Frame = -1 Query: 243 RANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLLF- 67 +A T+L LLQGCNS+++LRKIHA V+ NG Q HP+ISTKLL FCAVS +G L YA LLF Sbjct: 13 KAKTILKLLQGCNSLKKLRKIHAFVITNGLQHHPAISTKLLHFCAVSVSGSLPYAVLLFR 72 Query: 66 SLLQDPHPQDWNSIIRGSSRGP 1 + +P DWNSIIRG S+ P Sbjct: 73 HHILNPQTDDWNSIIRGFSQSP 94 >ref|XP_011622363.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Amborella trichopoda] Length = 673 Score = 102 bits (254), Expect = 1e-19 Identities = 49/90 (54%), Positives = 70/90 (77%), Gaps = 5/90 (5%) Frame = -1 Query: 264 NAAAKMCRA-----NTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVST 100 N++ KM + +T+L+LLQGCNSM++L+KIH Q+++NG++ H S+STKLL+FCAVS Sbjct: 106 NSSIKMATSPHNFTSTILSLLQGCNSMKKLQKIHTQIIVNGFENHLSLSTKLLNFCAVSA 165 Query: 99 AGDLSYAHLLFSLLQDPHPQDWNSIIRGSS 10 AG LSYA L+FS ++DP Q +NS+IR S Sbjct: 166 AGSLSYARLVFSHMKDPGTQAYNSMIRALS 195 >ref|XP_004304919.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Fragaria vesca subsp. vesca] Length = 589 Score = 100 bits (250), Expect = 3e-19 Identities = 49/89 (55%), Positives = 64/89 (71%), Gaps = 1/89 (1%) Frame = -1 Query: 264 NAAAKMCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLS 85 N A++ ++ +LTLLQGCNS+++L KIHA V+ NG HP IS KLL+FCAVS +G L Sbjct: 4 NHASQASKSKAILTLLQGCNSLRKLSKIHAYVITNGLHHHPDISGKLLNFCAVSVSGSLP 63 Query: 84 YAHLLF-SLLQDPHPQDWNSIIRGSSRGP 1 YA LLF +Q+P Q WNS+IRG S+ P Sbjct: 64 YAQLLFHHHIQNPETQHWNSMIRGFSQSP 92 >ref|XP_009366008.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Pyrus x bretschneideri] Length = 587 Score = 100 bits (248), Expect = 5e-19 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 1/85 (1%) Frame = -1 Query: 252 KMCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHL 73 ++ + + +LLQGCNS++RL+KIHA V+ NG Q P+IS KLL+FCAVS +G L+YA L Sbjct: 3 QISKTKAIRSLLQGCNSLKRLKKIHAHVITNGLQPDPAISNKLLNFCAVSVSGSLAYAQL 62 Query: 72 LF-SLLQDPHPQDWNSIIRGSSRGP 1 LF LQ+P QDWNS+IRG S P Sbjct: 63 LFYHHLQNPQTQDWNSLIRGFSNSP 87 >ref|XP_010549168.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Tarenaya hassleriana] Length = 581 Score = 99.0 bits (245), Expect = 1e-18 Identities = 48/76 (63%), Positives = 56/76 (73%) Frame = -1 Query: 243 RANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLLFS 64 +A +L LLQGCN M RLRKIH V ING Q PS+ KLL+FCAVS +G LSYA LLF+ Sbjct: 4 KAKAILRLLQGCNGMNRLRKIHTHVFINGLQNDPSLLDKLLNFCAVSVSGSLSYALLLFN 63 Query: 63 LLQDPHPQDWNSIIRG 16 +Q+P Q WNSIIRG Sbjct: 64 GIQNPSTQAWNSIIRG 79 >ref|XP_011041357.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Populus euphratica] Length = 600 Score = 98.6 bits (244), Expect = 1e-18 Identities = 44/81 (54%), Positives = 60/81 (74%) Frame = -1 Query: 243 RANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLLFS 64 +AN +LT+LQGCN++ RL+KI A V++NG Q HP+IS +L+FCAVS +G L YA LF Sbjct: 24 KANAILTVLQGCNNLTRLKKIQAHVIVNGLQNHPAISNSILNFCAVSISGSLPYAQHLFK 83 Query: 63 LLQDPHPQDWNSIIRGSSRGP 1 + +P Q WNSIIRG ++ P Sbjct: 84 HILNPQTQAWNSIIRGFAQSP 104 >ref|XP_008246339.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Prunus mume] Length = 601 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/89 (53%), Positives = 63/89 (70%), Gaps = 1/89 (1%) Frame = -1 Query: 264 NAAAKMCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLS 85 N + + +L LLQGCNS+ +L+KIHA V+ NG Q P+IS KLL+FCAVS +G L+ Sbjct: 13 NDVFQASKTKAILALLQGCNSLIKLKKIHAHVITNGLQHQPAISNKLLNFCAVSVSGCLA 72 Query: 84 YAHLLF-SLLQDPHPQDWNSIIRGSSRGP 1 YA LLF +Q+P QDWNS+IRG S+ P Sbjct: 73 YAQLLFHHHIQNPQTQDWNSMIRGFSQSP 101 >ref|XP_002323212.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550320693|gb|EEF04973.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 584 Score = 98.2 bits (243), Expect = 2e-18 Identities = 44/81 (54%), Positives = 60/81 (74%) Frame = -1 Query: 243 RANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLLFS 64 +AN +LT+LQGCN++ RL+KI A V++NG Q HP+IS +L+FCAVS +G L YA LF Sbjct: 8 KANAILTVLQGCNNLTRLKKIQAHVIVNGLQNHPAISNSILNFCAVSISGSLPYAQHLFR 67 Query: 63 LLQDPHPQDWNSIIRGSSRGP 1 + +P Q WNSIIRG ++ P Sbjct: 68 HILNPQTQAWNSIIRGFAQSP 88 >ref|XP_007207191.1| hypothetical protein PRUPE_ppa017094mg [Prunus persica] gi|462402833|gb|EMJ08390.1| hypothetical protein PRUPE_ppa017094mg [Prunus persica] Length = 590 Score = 97.4 bits (241), Expect = 3e-18 Identities = 49/89 (55%), Positives = 63/89 (70%), Gaps = 1/89 (1%) Frame = -1 Query: 264 NAAAKMCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLS 85 N + +A +L LLQGCNS+ RL+KIHA V+ NG Q +IS KLL+FCAVS +G L+ Sbjct: 13 NDVFQASKAKAILALLQGCNSLIRLKKIHAYVITNGLQHQTAISNKLLNFCAVSVSGCLA 72 Query: 84 YAHLLF-SLLQDPHPQDWNSIIRGSSRGP 1 YA LLF +Q+P QDWNS+IRG S+ P Sbjct: 73 YAQLLFHHHIQNPQTQDWNSMIRGFSQSP 101 >ref|XP_008345659.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550-like [Malus domestica] Length = 355 Score = 97.1 bits (240), Expect = 4e-18 Identities = 47/82 (57%), Positives = 60/82 (73%), Gaps = 1/82 (1%) Frame = -1 Query: 243 RANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLLF- 67 + +L+LLQGCN ++RL+KIHA V+ G Q P+IS KLL+FCAVS +G L+YA LLF Sbjct: 6 KTKAILSLLQGCNGLKRLKKIHAHVITIGLQPDPAISNKLLNFCAVSVSGSLAYAQLLFY 65 Query: 66 SLLQDPHPQDWNSIIRGSSRGP 1 LQ+P QDWNS+IRG S P Sbjct: 66 HHLQNPQTQDWNSLIRGFSNSP 87 >ref|XP_008441882.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] gi|659082519|ref|XP_008441884.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] gi|659082521|ref|XP_008441885.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] gi|659082523|ref|XP_008441886.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] gi|659082525|ref|XP_008441887.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] gi|659082527|ref|XP_008441888.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] gi|659082529|ref|XP_008441889.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] gi|659082531|ref|XP_008441890.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] gi|659082533|ref|XP_008441891.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550 [Cucumis melo] Length = 579 Score = 95.9 bits (237), Expect = 9e-18 Identities = 43/78 (55%), Positives = 58/78 (74%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 M + +LTLLQGCNS++RLRKIHA V+++G H +I+ KLL+FCA+S +G L+YA LL Sbjct: 1 MSKEKAILTLLQGCNSLKRLRKIHAHVIVSGLHHHVAIANKLLNFCAISVSGSLAYAQLL 60 Query: 69 FSLLQDPHPQDWNSIIRG 16 F + P + WNSIIRG Sbjct: 61 FHQTEFPQTEAWNSIIRG 78 >ref|XP_010037930.1| PREDICTED: pentatricopeptide repeat-containing protein At3g56550-like [Eucalyptus grandis] gi|629120028|gb|KCW84518.1| hypothetical protein EUGRSUZ_B01355 [Eucalyptus grandis] Length = 580 Score = 94.7 bits (234), Expect = 2e-17 Identities = 45/82 (54%), Positives = 59/82 (71%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 M A T+L LLQGCN+++RL+ IHA+V ++G Q PSIS KLL FCAVS +G L+YA L Sbjct: 1 MSTAQTVLALLQGCNTLRRLKAIHARVFVHGLQSDPSISAKLLHFCAVSVSGCLAYARTL 60 Query: 69 FSLLQDPHPQDWNSIIRGSSRG 4 F ++ P DW+SIIRG + G Sbjct: 61 FDRIECPQTHDWSSIIRGFAVG 82 >gb|KGN61250.1| hypothetical protein Csa_2G074120 [Cucumis sativus] Length = 622 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/78 (53%), Positives = 56/78 (71%) Frame = -1 Query: 249 MCRANTLLTLLQGCNSMQRLRKIHAQVLINGYQQHPSISTKLLSFCAVSTAGDLSYAHLL 70 M +L LLQGCNS++RLRKIHA V+++G H I+ KLL+FCA+S +G L+YA LL Sbjct: 1 MSNEKAILALLQGCNSLKRLRKIHAHVIVSGLHHHVPIANKLLNFCAISVSGSLAYAQLL 60 Query: 69 FSLLQDPHPQDWNSIIRG 16 F ++ P + WNSIIRG Sbjct: 61 FHQMECPQTEAWNSIIRG 78