BLASTX nr result
ID: Anemarrhena21_contig00053422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00053422 (816 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011024024.1| PREDICTED: pentatricopeptide repeat-containi... 47 4e-06 ref|XP_002322250.2| hypothetical protein POPTR_0015s10720g [Popu... 47 5e-06 ref|XP_008784651.1| PREDICTED: pentatricopeptide repeat-containi... 43 9e-06 >ref|XP_011024024.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Populus euphratica] Length = 704 Score = 47.0 bits (110), Expect(2) = 4e-06 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -3 Query: 352 SIYDSLVTTCVGLQLA*DAIFVFLYQIDNLFEFDQYFKNLIVL 224 S YD+LV C+GL+ VF Y IDN FEFDQY +N ++L Sbjct: 132 STYDALVNACIGLRSVRGVKRVFNYMIDNGFEFDQYMRNRVLL 174 Score = 31.6 bits (70), Expect(2) = 4e-06 Identities = 21/37 (56%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 197 DACWLFDEMFERNSFS*NTMIS-LFLLGSFAETSDLF 90 DA LFDEM ERN S NT+IS L +G F E LF Sbjct: 184 DARGLFDEMPERNLVSWNTIISGLVDVGDFLEAFRLF 220 >ref|XP_002322250.2| hypothetical protein POPTR_0015s10720g [Populus trichocarpa] gi|550322450|gb|EEF06377.2| hypothetical protein POPTR_0015s10720g [Populus trichocarpa] Length = 704 Score = 47.0 bits (110), Expect(2) = 5e-06 Identities = 22/43 (51%), Positives = 28/43 (65%) Frame = -3 Query: 352 SIYDSLVTTCVGLQLA*DAIFVFLYQIDNLFEFDQYFKNLIVL 224 S YD+LV C+GL+ VF Y IDN FEFDQY +N ++L Sbjct: 132 STYDALVNACIGLRSVRGVKRVFNYMIDNGFEFDQYMRNRVLL 174 Score = 31.2 bits (69), Expect(2) = 5e-06 Identities = 21/37 (56%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 197 DACWLFDEMFERNSFS*NTMIS-LFLLGSFAETSDLF 90 DA LFDEM ERN S NT+IS L +G F E LF Sbjct: 184 DARRLFDEMPERNLVSWNTIISGLVDVGDFMEAFRLF 220 >ref|XP_008784651.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Phoenix dactylifera] gi|672122632|ref|XP_008784652.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Phoenix dactylifera] gi|672122634|ref|XP_008784653.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Phoenix dactylifera] gi|672122636|ref|XP_008784654.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Phoenix dactylifera] gi|672122638|ref|XP_008784655.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Phoenix dactylifera] gi|672122640|ref|XP_008784656.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Phoenix dactylifera] gi|672122642|ref|XP_008784657.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Phoenix dactylifera] Length = 709 Score = 43.1 bits (100), Expect(2) = 9e-06 Identities = 22/48 (45%), Positives = 30/48 (62%) Frame = -3 Query: 355 ASIYDSLVTTCVGLQLA*DAIFVFLYQIDNLFEFDQYFKNLIVLKCLE 212 AS YDSLV CV L+ VF + I++ FEFDQY +N ++L L+ Sbjct: 135 ASTYDSLVNACVNLRSVGAVKTVFRHMIESGFEFDQYMRNRVLLMHLK 182 Score = 34.3 bits (77), Expect(2) = 9e-06 Identities = 22/39 (56%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = -2 Query: 203 IPDACWLFDEMFERNSFS*NTMIS-LFLLGSFAETSDLF 90 + DA LFDEM ERN S NTMI+ L GS+ E DLF Sbjct: 186 LADARRLFDEMPERNIVSLNTMITGLVDSGSYEEAFDLF 224