BLASTX nr result
ID: Anemarrhena21_contig00053116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00053116 (330 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AET03716.2| receptor-like kinase theseus protein [Medicago tr... 58 2e-06 ref|XP_003629240.1| Protein kinase 2A [Medicago truncatula] 58 2e-06 >gb|AET03716.2| receptor-like kinase theseus protein [Medicago truncatula] Length = 426 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -1 Query: 147 MLVCEYVPLGSLLEYMAGLKKRKTLTWRQRINIAI*AAKG--KLHNKI 10 +LV EYVP GSLLEYM G +R++LTW+QRINIAI AAKG LH K+ Sbjct: 150 ILVYEYVPNGSLLEYMMG-NRRRSLTWKQRINIAIGAAKGIAYLHEKV 196 >ref|XP_003629240.1| Protein kinase 2A [Medicago truncatula] Length = 435 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -1 Query: 147 MLVCEYVPLGSLLEYMAGLKKRKTLTWRQRINIAI*AAKG--KLHNKI 10 +LV EYVP GSLLEYM G +R++LTW+QRINIAI AAKG LH K+ Sbjct: 159 ILVYEYVPNGSLLEYMMG-NRRRSLTWKQRINIAIGAAKGIAYLHEKV 205