BLASTX nr result
ID: Anemarrhena21_contig00053001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00053001 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010916036.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_008809631.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 gb|ERM97234.1| hypothetical protein AMTR_s00119p00084460 [Ambore... 56 8e-06 >ref|XP_010916036.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial [Elaeis guineensis] Length = 420 Score = 60.8 bits (146), Expect = 3e-07 Identities = 36/83 (43%), Positives = 47/83 (56%), Gaps = 14/83 (16%) Frame = -1 Query: 211 PFPIFLSPETLTLI-----------YPYST---RCRPKERRNPAAPPHLDQPKLELAISQ 74 P PI P+ LTL +PYST R P+ +R+ APP +DQ +L+ AIS+ Sbjct: 30 PQPISSHPKILTLTPLIPRPNSPPTFPYSTTRSRRTPRSKRSKRAPPPVDQAQLDRAISE 89 Query: 73 LPPRFTPSDLTHLLSRISDPHLC 5 LP RFT ++L L R SDP LC Sbjct: 90 LPARFTSAELAAALGRHSDPRLC 112 >ref|XP_008809631.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial [Phoenix dactylifera] Length = 422 Score = 60.1 bits (144), Expect = 6e-07 Identities = 36/83 (43%), Positives = 48/83 (57%), Gaps = 14/83 (16%) Frame = -1 Query: 211 PFPIFLSPETLTLI-----------YPYST---RCRPKERRNPAAPPHLDQPKLELAISQ 74 P PI P+ LTLI +PYST R P+ +R+ APP +DQ +++ AIS+ Sbjct: 30 PQPISSHPKILTLISPIARPDSLPTFPYSTTRSRRIPRSKRSKRAPPPVDQAQIDRAISE 89 Query: 73 LPPRFTPSDLTHLLSRISDPHLC 5 LP RFT +DL L+R DP LC Sbjct: 90 LPARFTSADLAAALARHPDPCLC 112 >gb|ERM97234.1| hypothetical protein AMTR_s00119p00084460 [Amborella trichopoda] Length = 640 Score = 56.2 bits (134), Expect = 8e-06 Identities = 37/93 (39%), Positives = 46/93 (49%) Frame = -1 Query: 283 PSSPLRFNSPNPLLPTMLRRLLHAPFPIFLSPETLTLIYPYSTRCRPKERRNPAAPPHLD 104 P S + NSP L R + P +PE S++ RPK RR P LD Sbjct: 251 PKSKFQLNSPLNLTQFHSRFISSGPQSSRRTPEPNNPPPKTSSKFRPKYRRKMPNRP-LD 309 Query: 103 QPKLELAISQLPPRFTPSDLTHLLSRISDPHLC 5 ++ A+SQLPPRFTP DL H+LS DP C Sbjct: 310 LAYVQQALSQLPPRFTPEDLLHILSSQKDPLAC 342