BLASTX nr result
ID: Anemarrhena21_contig00051802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00051802 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528720.1| conserved hypothetical protein [Ricinus comm... 65 2e-08 ref|XP_002525524.1| conserved hypothetical protein [Ricinus comm... 64 4e-08 ref|XP_002534679.1| conserved hypothetical protein [Ricinus comm... 56 8e-06 >ref|XP_002528720.1| conserved hypothetical protein [Ricinus communis] gi|223531814|gb|EEF33632.1| conserved hypothetical protein [Ricinus communis] Length = 124 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 223 SGMRTEIPEFHDSLQAEEFLDWLVTVEEILDF 318 SGMRTEIPEFH SLQAEEFLDWL TVEEILDF Sbjct: 44 SGMRTEIPEFHGSLQAEEFLDWLATVEEILDF 75 >ref|XP_002525524.1| conserved hypothetical protein [Ricinus communis] gi|223535203|gb|EEF36882.1| conserved hypothetical protein [Ricinus communis] Length = 132 Score = 63.9 bits (154), Expect = 4e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 223 SGMRTEIPEFHDSLQAEEFLDWLVTVEEILDF 318 SGMRTEIPEFH SLQAEEFLDWL TVEEILDF Sbjct: 59 SGMRTEIPEFHGSLQAEEFLDWLPTVEEILDF 90 >ref|XP_002534679.1| conserved hypothetical protein [Ricinus communis] gi|223524777|gb|EEF27704.1| conserved hypothetical protein [Ricinus communis] Length = 272 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/32 (84%), Positives = 27/32 (84%) Frame = +1 Query: 223 SGMRTEIPEFHDSLQAEEFLDWLVTVEEILDF 318 SGMRTEI EFH SLQAEE LDWL VEEILDF Sbjct: 53 SGMRTEILEFHGSLQAEELLDWLAMVEEILDF 84