BLASTX nr result
ID: Anemarrhena21_contig00050100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00050100 (355 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009402345.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthio... 56 8e-06 >ref|XP_009402345.1| PREDICTED: 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 [Musa acuminata subsp. malaccensis] Length = 219 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 113 PVKHISIKRRIPFEDGKEEVIQAWYMDDSDEDQRLPH 3 P+ + F+DGKEEVIQAWYMDDS+EDQRLPH Sbjct: 13 PISWEGSEMETAFQDGKEEVIQAWYMDDSEEDQRLPH 49