BLASTX nr result
ID: Anemarrhena21_contig00048626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00048626 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010921699.1| PREDICTED: pentatricopeptide repeat-containi... 72 1e-10 ref|XP_010691160.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 emb|CDO98265.1| unnamed protein product [Coffea canephora] 69 1e-09 ref|XP_009411205.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_012856872.1| PREDICTED: pentatricopeptide repeat-containi... 67 6e-09 gb|EYU21622.1| hypothetical protein MIMGU_mgv1a019624mg, partial... 67 6e-09 ref|XP_002462300.1| hypothetical protein SORBIDRAFT_02g023500 [S... 65 1e-08 ref|XP_011073636.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-08 ref|NP_001152455.1| GTP binding protein [Zea mays] gi|195656487|... 63 9e-08 ref|XP_004956698.1| PREDICTED: pentatricopeptide repeat-containi... 63 9e-08 ref|XP_008668622.1| PREDICTED: empty pericarp 2 isoform X1 [Zea ... 63 9e-08 gb|EEE69598.1| hypothetical protein OsJ_29150 [Oryza sativa Japo... 62 1e-07 gb|EEC84482.1| hypothetical protein OsI_31142 [Oryza sativa Indi... 62 1e-07 ref|XP_010238126.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_004235996.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_006661177.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_007144700.1| hypothetical protein PHAVU_007G177800g [Phas... 61 3e-07 ref|XP_006842064.2| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_002530894.1| pentatricopeptide repeat-containing protein,... 61 3e-07 gb|ERN03739.1| hypothetical protein AMTR_s00078p00045650 [Ambore... 61 3e-07 >ref|XP_010921699.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Elaeis guineensis] Length = 531 Score = 72.4 bits (176), Expect = 1e-10 Identities = 39/82 (47%), Positives = 54/82 (65%), Gaps = 4/82 (4%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHT----SNQDVLSSDFFHILFFAYSKANLPLDAV 171 SH V+++SLAA R FPL W+ LS+L + S+ D + F +LF +YS A LP DAV Sbjct: 124 SHLVVIESLAAARQFPLVWSFLSELRDSGLRRSDADEIRPKAFWLLFRSYSGACLPADAV 183 Query: 172 RTFNKMPEFGFCPNLDELHLLL 237 R F +MP+F P+L++LH LL Sbjct: 184 RAFKRMPDFRLQPDLEDLHQLL 205 >ref|XP_010691160.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870848395|gb|KMT00684.1| hypothetical protein BVRB_9g219730 [Beta vulgaris subsp. vulgaris] Length = 536 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/78 (43%), Positives = 52/78 (66%), Gaps = 1/78 (1%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFN 183 S+++L+ L + FPL W LS++ N + L + F ++F AY +ANLP+DA+R FN Sbjct: 116 SYKILIDVLGTSKQFPLIWDLLSEMKSIENFE-LCPEIFWVIFGAYCRANLPIDAIRAFN 174 Query: 184 KMPEFGFCPNLDEL-HLL 234 +M EFG PNL+++ HLL Sbjct: 175 RMDEFGIRPNLNDVDHLL 192 >emb|CDO98265.1| unnamed protein product [Coffea canephora] Length = 532 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/78 (42%), Positives = 51/78 (65%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFN 183 SH +L+ L + + FPL W L ++ T ++ SS+ F I+F AYS+ANLP +A+R FN Sbjct: 127 SHHILVDILGSSKQFPLTWDFLVEMRDTRKFEI-SSEIFWIVFRAYSRANLPAEAIRAFN 185 Query: 184 KMPEFGFCPNLDELHLLL 237 KM +FG P +++L L+ Sbjct: 186 KMLDFGITPTVNDLDQLI 203 >ref|XP_009411205.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Musa acuminata subsp. malaccensis] Length = 503 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 1/79 (1%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSN-QDVLSSDFFHILFFAYSKANLPLDAVRTF 180 +H L+ +L A R FPL W+ LS+L DV + F +LF Y++A+LP DA+R F Sbjct: 98 AHLALVHALGAARQFPLLWSLLSELRDAGRGSDVARPETFWLLFRFYARASLPDDAIRAF 157 Query: 181 NKMPEFGFCPNLDELHLLL 237 +MP+FG P L++ H LL Sbjct: 158 RRMPDFGIQPGLEDFHHLL 176 >ref|XP_012856872.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Erythranthe guttatus] Length = 513 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/78 (42%), Positives = 50/78 (64%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFN 183 S+ +L+ L + R FP W L++ T + ++ S + F I+F AYS+ANLP DA+R FN Sbjct: 101 SYHILVDILGSSRQFPFLWDFLTETKRTESCEI-SREIFWIVFRAYSRANLPSDAIRAFN 159 Query: 184 KMPEFGFCPNLDELHLLL 237 KM ++G P +D+L LL Sbjct: 160 KMLDYGITPCVDDLDQLL 177 >gb|EYU21622.1| hypothetical protein MIMGU_mgv1a019624mg, partial [Erythranthe guttata] Length = 510 Score = 66.6 bits (161), Expect = 6e-09 Identities = 33/78 (42%), Positives = 50/78 (64%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFN 183 S+ +L+ L + R FP W L++ T + ++ S + F I+F AYS+ANLP DA+R FN Sbjct: 101 SYHILVDILGSSRQFPFLWDFLTETKRTESCEI-SREIFWIVFRAYSRANLPSDAIRAFN 159 Query: 184 KMPEFGFCPNLDELHLLL 237 KM ++G P +D+L LL Sbjct: 160 KMLDYGITPCVDDLDQLL 177 >ref|XP_002462300.1| hypothetical protein SORBIDRAFT_02g023500 [Sorghum bicolor] gi|241925677|gb|EER98821.1| hypothetical protein SORBIDRAFT_02g023500 [Sorghum bicolor] Length = 541 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/75 (49%), Positives = 47/75 (62%) Frame = +1 Query: 13 VLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFNKMP 192 +L SLA RLFPL + LSDL + LS D F +LF AY++A LP DA+R F+ M Sbjct: 119 ILAGSLAGARLFPLLRSLLSDL----PRPALSRDLFPLLFRAYARAGLPDDAIRAFSSME 174 Query: 193 EFGFCPNLDELHLLL 237 FGF P + +LH LL Sbjct: 175 RFGFLPTVADLHSLL 189 >ref|XP_011073636.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Sesamum indicum] gi|747041560|ref|XP_011073643.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Sesamum indicum] Length = 529 Score = 62.8 bits (151), Expect = 9e-08 Identities = 32/78 (41%), Positives = 48/78 (61%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFN 183 S+ +L+ L + R FP W L ++ T + ++ S F I+F AY +ANLP DA+R FN Sbjct: 117 SYHILVDILGSSRQFPFLWDFLVEMSKTESCEI-SRQIFWIVFRAYGRANLPGDAIRAFN 175 Query: 184 KMPEFGFCPNLDELHLLL 237 +M +FG P +D+L LL Sbjct: 176 RMVDFGIRPCVDDLDQLL 193 >ref|NP_001152455.1| GTP binding protein [Zea mays] gi|195656487|gb|ACG47711.1| GTP binding protein [Zea mays] Length = 455 Score = 62.8 bits (151), Expect = 9e-08 Identities = 36/75 (48%), Positives = 47/75 (62%) Frame = +1 Query: 13 VLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFNKMP 192 +L SLA RLFPL + LSDL ++ LS D F +LF AY++A LP DA+R F+ M Sbjct: 122 ILAGSLAGTRLFPLLRSLLSDLPRSA----LSRDLFPLLFRAYARAGLPEDAIRAFSSME 177 Query: 193 EFGFCPNLDELHLLL 237 F F P + +LH LL Sbjct: 178 RFCFLPTVADLHSLL 192 >ref|XP_004956698.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Setaria italica] Length = 457 Score = 62.8 bits (151), Expect = 9e-08 Identities = 38/75 (50%), Positives = 46/75 (61%) Frame = +1 Query: 13 VLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFNKMP 192 VL SLA RLFPL + LSDL ++ LS D F +LF AY++A LP DA R F+ M Sbjct: 124 VLAGSLAGARLFPLLRSLLSDLPRSA----LSRDLFPLLFRAYARAGLPDDATRAFSSME 179 Query: 193 EFGFCPNLDELHLLL 237 FGF P +LH LL Sbjct: 180 GFGFPPTAADLHSLL 194 >ref|XP_008668622.1| PREDICTED: empty pericarp 2 isoform X1 [Zea mays] gi|414589415|tpg|DAA39986.1| TPA: empty pericarp 2 [Zea mays] Length = 455 Score = 62.8 bits (151), Expect = 9e-08 Identities = 36/75 (48%), Positives = 47/75 (62%) Frame = +1 Query: 13 VLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFNKMP 192 +L SLA RLFPL + LSDL ++ LS D F +LF AY++A LP DA+R F+ M Sbjct: 122 ILAGSLAGARLFPLLRSLLSDLPRSA----LSRDLFPLLFRAYARAGLPEDAIRAFSSME 177 Query: 193 EFGFCPNLDELHLLL 237 F F P + +LH LL Sbjct: 178 RFCFLPTVADLHSLL 192 >gb|EEE69598.1| hypothetical protein OsJ_29150 [Oryza sativa Japonica Group] Length = 579 Score = 62.4 bits (150), Expect = 1e-07 Identities = 37/75 (49%), Positives = 46/75 (61%) Frame = +1 Query: 13 VLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFNKMP 192 VL SLA RLFPL + LSDL ++ LS F +LF AYS+A LP DA+R F+ M Sbjct: 127 VLANSLAGARLFPLLRSLLSDLPPSA----LSRGLFPLLFRAYSRARLPEDAIRAFSSMA 182 Query: 193 EFGFCPNLDELHLLL 237 FGF P + + H LL Sbjct: 183 GFGFPPTIADFHSLL 197 >gb|EEC84482.1| hypothetical protein OsI_31142 [Oryza sativa Indica Group] Length = 586 Score = 62.4 bits (150), Expect = 1e-07 Identities = 37/75 (49%), Positives = 46/75 (61%) Frame = +1 Query: 13 VLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFNKMP 192 VL SLA RLFPL + LSDL ++ LS F +LF AYS+A LP DA+R F+ M Sbjct: 134 VLANSLAGARLFPLLRSLLSDLPPSA----LSRGLFPLLFRAYSRARLPEDAIRAFSSMA 189 Query: 193 EFGFCPNLDELHLLL 237 FGF P + + H LL Sbjct: 190 GFGFPPTIADFHSLL 204 >ref|XP_010238126.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Brachypodium distachyon] Length = 455 Score = 62.0 bits (149), Expect = 1e-07 Identities = 38/75 (50%), Positives = 45/75 (60%) Frame = +1 Query: 13 VLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFNKMP 192 +L SLA RLFPL + LSDL T+ LS F LF AYS+A LP DA+R F+ M Sbjct: 120 ILANSLAGARLFPLLRSLLSDLPPTA----LSRGLFPRLFRAYSRALLPEDAIRAFSSMA 175 Query: 193 EFGFCPNLDELHLLL 237 FGF P L + H LL Sbjct: 176 GFGFHPTLSDFHSLL 190 >ref|XP_004235996.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Solanum lycopersicum] Length = 550 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/78 (41%), Positives = 48/78 (61%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFN 183 S R+L+ L + + FPL W L ++ T+ ++ + F ++F AYS+A LP DA+R FN Sbjct: 139 SFRILVDILGSSKQFPLIWDFLVEM-RTNRSCEITPEIFWLVFRAYSRAGLPADAIRAFN 197 Query: 184 KMPEFGFCPNLDELHLLL 237 KM +FG P L +L LL Sbjct: 198 KMVDFGIKPCLADLDKLL 215 >ref|XP_006661177.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial-like [Oryza brachyantha] Length = 456 Score = 61.2 bits (147), Expect = 3e-07 Identities = 36/75 (48%), Positives = 46/75 (61%) Frame = +1 Query: 13 VLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFNKMP 192 +L SLA RLFPL + LSDL ++ LS F +LF AYS+A LP DA+R F+ M Sbjct: 123 ILANSLAGARLFPLLRSLLSDLPPSA----LSRGLFPLLFRAYSRARLPDDAIRVFSSMA 178 Query: 193 EFGFCPNLDELHLLL 237 FGF P + + H LL Sbjct: 179 GFGFPPMIGDFHSLL 193 >ref|XP_007144700.1| hypothetical protein PHAVU_007G177800g [Phaseolus vulgaris] gi|561017890|gb|ESW16694.1| hypothetical protein PHAVU_007G177800g [Phaseolus vulgaris] Length = 524 Score = 61.2 bits (147), Expect = 3e-07 Identities = 31/79 (39%), Positives = 50/79 (63%) Frame = +1 Query: 1 LSHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTF 180 LS +L++ L + + F + W L ++ S V+++D F ++F AYS+ANLP A+R+F Sbjct: 112 LSFHILVEILGSCQQFAILWDFLIEM-RDSRSYVINADIFWLIFKAYSRANLPDGAIRSF 170 Query: 181 NKMPEFGFCPNLDELHLLL 237 N+M EFG P + +L LL Sbjct: 171 NRMDEFGITPTVHDLDKLL 189 >ref|XP_006842064.2| PREDICTED: pentatricopeptide repeat-containing protein At1g52640, mitochondrial [Amborella trichopoda] Length = 553 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/80 (37%), Positives = 49/80 (61%), Gaps = 2/80 (2%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQD--VLSSDFFHILFFAYSKANLPLDAVRT 177 S+R+L+ L ++R FP+ W DL D + + F ++F +Y++ANLP DA+R Sbjct: 125 SYRILVDILGSNRHFPMIW----DLVFGMKNDGFEIKRELFWVMFRSYARANLPTDAIRA 180 Query: 178 FNKMPEFGFCPNLDELHLLL 237 F +M EFG P++D+L L+ Sbjct: 181 FRRMEEFGIKPSIDDLDQLI 200 >ref|XP_002530894.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223529547|gb|EEF31500.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 519 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/78 (38%), Positives = 49/78 (62%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQDVLSSDFFHILFFAYSKANLPLDAVRTFN 183 S+ +L+ L + + F L W L ++ + + ++ S F ++F AYS+ANLP DA+R F+ Sbjct: 110 SYHILVDILGSSKQFALLWDFLIEIRESQDFEI-SPQVFWLVFRAYSRANLPSDAIRAFD 168 Query: 184 KMPEFGFCPNLDELHLLL 237 +M EFG P +D+L LL Sbjct: 169 RMVEFGLKPTIDDLDQLL 186 >gb|ERN03739.1| hypothetical protein AMTR_s00078p00045650 [Amborella trichopoda] Length = 595 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/80 (37%), Positives = 49/80 (61%), Gaps = 2/80 (2%) Frame = +1 Query: 4 SHRVLLQSLAAHRLFPLAWAHLSDLYHTSNQD--VLSSDFFHILFFAYSKANLPLDAVRT 177 S+R+L+ L ++R FP+ W DL D + + F ++F +Y++ANLP DA+R Sbjct: 167 SYRILVDILGSNRHFPMIW----DLVFGMKNDGFEIKRELFWVMFRSYARANLPTDAIRA 222 Query: 178 FNKMPEFGFCPNLDELHLLL 237 F +M EFG P++D+L L+ Sbjct: 223 FRRMEEFGIKPSIDDLDQLI 242