BLASTX nr result
ID: Anemarrhena21_contig00043485
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00043485 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828305.1| PREDICTED: probable prolyl 4-hydroxylase 4 [... 63 9e-08 ref|XP_009412184.1| PREDICTED: probable prolyl 4-hydroxylase 4 i... 61 3e-07 ref|XP_009412183.1| PREDICTED: probable prolyl 4-hydroxylase 4 i... 61 3e-07 ref|XP_011090892.1| PREDICTED: probable prolyl 4-hydroxylase 4 [... 60 4e-07 ref|XP_004296772.2| PREDICTED: probable prolyl 4-hydroxylase 4 [... 59 1e-06 ref|XP_012454819.1| PREDICTED: probable prolyl 4-hydroxylase 4 [... 59 1e-06 gb|KHN03021.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja] 59 1e-06 gb|KHG08217.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium a... 59 1e-06 ref|XP_009352176.1| PREDICTED: probable prolyl 4-hydroxylase 4 [... 59 1e-06 ref|XP_008360309.1| PREDICTED: prolyl 4-hydroxylase subunit alph... 59 1e-06 ref|XP_008351224.1| PREDICTED: uncharacterized protein LOC103414... 59 1e-06 ref|XP_008223071.1| PREDICTED: prolyl 4-hydroxylase subunit alph... 59 1e-06 ref|XP_007154205.1| hypothetical protein PHAVU_003G098900g [Phas... 59 1e-06 ref|XP_004508327.1| PREDICTED: probable prolyl 4-hydroxylase 4 [... 59 1e-06 ref|XP_007223204.1| hypothetical protein PRUPE_ppa009336mg [Prun... 59 1e-06 ref|NP_001241485.1| uncharacterized protein LOC100783075 precurs... 59 1e-06 gb|AFK35574.1| unknown [Lotus japonicus] 58 3e-06 ref|XP_011006089.1| PREDICTED: probable prolyl 4-hydroxylase 4 [... 57 4e-06 ref|XP_010912106.1| PREDICTED: probable prolyl 4-hydroxylase 4 [... 57 4e-06 gb|KHN33098.1| Prolyl 4-hydroxylase subunit alpha-2 [Glycine soja] 57 4e-06 >ref|XP_012828305.1| PREDICTED: probable prolyl 4-hydroxylase 4 [Erythranthe guttatus] gi|604345282|gb|EYU43864.1| hypothetical protein MIMGU_mgv1a014476mg [Erythranthe guttata] Length = 188 Score = 62.8 bits (151), Expect = 9e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -1 Query: 84 FSENGEDIQVLRYEPGQKYDPHYDYFTD 1 + ENGEDIQVLRYEPGQKYDPHYDYFTD Sbjct: 4 YIENGEDIQVLRYEPGQKYDPHYDYFTD 31 >ref|XP_009412184.1| PREDICTED: probable prolyl 4-hydroxylase 4 isoform X2 [Musa acuminata subsp. malaccensis] Length = 273 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKYDPHYDYF+D Sbjct: 120 ENGEDIQVLRYEPGQKYDPHYDYFSD 145 >ref|XP_009412183.1| PREDICTED: probable prolyl 4-hydroxylase 4 isoform X1 [Musa acuminata subsp. malaccensis] Length = 299 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKYDPHYDYF+D Sbjct: 120 ENGEDIQVLRYEPGQKYDPHYDYFSD 145 >ref|XP_011090892.1| PREDICTED: probable prolyl 4-hydroxylase 4 [Sesamum indicum] Length = 292 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKYDPHYDYF D Sbjct: 115 ENGEDIQVLRYEPGQKYDPHYDYFAD 140 >ref|XP_004296772.2| PREDICTED: probable prolyl 4-hydroxylase 4 [Fragaria vesca subsp. vesca] Length = 333 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKY+PHYDYF D Sbjct: 154 ENGEDIQVLRYEPGQKYEPHYDYFAD 179 >ref|XP_012454819.1| PREDICTED: probable prolyl 4-hydroxylase 4 [Gossypium raimondii] gi|763805575|gb|KJB72513.1| hypothetical protein B456_011G182800 [Gossypium raimondii] gi|763805576|gb|KJB72514.1| hypothetical protein B456_011G182800 [Gossypium raimondii] Length = 301 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYE GQKYDPHYDYFTD Sbjct: 123 ENGEDIQVLRYEHGQKYDPHYDYFTD 148 >gb|KHN03021.1| Prolyl 4-hydroxylase subunit alpha-1 [Glycine soja] Length = 297 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYE GQKYDPHYDYFTD Sbjct: 118 ENGEDIQVLRYEHGQKYDPHYDYFTD 143 >gb|KHG08217.1| Prolyl 4-hydroxylase subunit alpha-1 [Gossypium arboreum] Length = 301 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYE GQKYDPHYDYFTD Sbjct: 123 ENGEDIQVLRYEHGQKYDPHYDYFTD 148 >ref|XP_009352176.1| PREDICTED: probable prolyl 4-hydroxylase 4 [Pyrus x bretschneideri] Length = 300 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKY+PHYDYF D Sbjct: 121 ENGEDIQVLRYEPGQKYEPHYDYFVD 146 >ref|XP_008360309.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1-like [Malus domestica] Length = 301 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKY+PHYDYF D Sbjct: 122 ENGEDIQVLRYEPGQKYEPHYDYFVD 147 >ref|XP_008351224.1| PREDICTED: uncharacterized protein LOC103414638 [Malus domestica] Length = 340 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKY+PHYDYF D Sbjct: 161 ENGEDIQVLRYEPGQKYEPHYDYFVD 186 >ref|XP_008223071.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Prunus mume] Length = 301 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKY+PHYDYF D Sbjct: 122 ENGEDIQVLRYEPGQKYEPHYDYFAD 147 >ref|XP_007154205.1| hypothetical protein PHAVU_003G098900g [Phaseolus vulgaris] gi|561027559|gb|ESW26199.1| hypothetical protein PHAVU_003G098900g [Phaseolus vulgaris] Length = 297 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYE GQKYDPHYDYFTD Sbjct: 118 ENGEDIQVLRYEHGQKYDPHYDYFTD 143 >ref|XP_004508327.1| PREDICTED: probable prolyl 4-hydroxylase 4 [Cicer arietinum] Length = 297 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYE GQKYDPHYDYFTD Sbjct: 118 ENGEDIQVLRYEHGQKYDPHYDYFTD 143 >ref|XP_007223204.1| hypothetical protein PRUPE_ppa009336mg [Prunus persica] gi|462420140|gb|EMJ24403.1| hypothetical protein PRUPE_ppa009336mg [Prunus persica] Length = 297 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYEPGQKY+PHYDYF D Sbjct: 118 ENGEDIQVLRYEPGQKYEPHYDYFAD 143 >ref|NP_001241485.1| uncharacterized protein LOC100783075 precursor [Glycine max] gi|571532068|ref|XP_006600167.1| PREDICTED: uncharacterized protein LOC100783075 isoform X1 [Glycine max] gi|255645457|gb|ACU23224.1| unknown [Glycine max] gi|734319368|gb|KHN03408.1| Prolyl 4-hydroxylase subunit alpha-2 [Glycine soja] Length = 298 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYE GQKYDPHYDYFTD Sbjct: 119 ENGEDIQVLRYEHGQKYDPHYDYFTD 144 >gb|AFK35574.1| unknown [Lotus japonicus] Length = 297 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGED+QVLRYE GQKYDPHYDYFTD Sbjct: 118 ENGEDMQVLRYEHGQKYDPHYDYFTD 143 >ref|XP_011006089.1| PREDICTED: probable prolyl 4-hydroxylase 4 [Populus euphratica] Length = 300 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYE GQKYDPHYDYF+D Sbjct: 121 ENGEDIQVLRYEHGQKYDPHYDYFSD 146 >ref|XP_010912106.1| PREDICTED: probable prolyl 4-hydroxylase 4 [Elaeis guineensis] Length = 298 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/26 (92%), Positives = 25/26 (96%) Frame = -1 Query: 78 ENGEDIQVLRYEPGQKYDPHYDYFTD 1 ENGEDIQVLRYE GQKYDPHYDYF+D Sbjct: 119 ENGEDIQVLRYEHGQKYDPHYDYFSD 144 >gb|KHN33098.1| Prolyl 4-hydroxylase subunit alpha-2 [Glycine soja] Length = 306 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -1 Query: 111 DKRSFS*IFFSENGEDIQVLRYEPGQKYDPHYDYFTD 1 DK S + ENGEDIQVLRYE GQKYDPHYDYF D Sbjct: 116 DKISSWTLLPKENGEDIQVLRYEHGQKYDPHYDYFAD 152