BLASTX nr result
ID: Anemarrhena21_contig00042190
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00042190 (571 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010912878.1| PREDICTED: pentatricopeptide repeat-containi... 112 9e-23 ref|XP_008776306.1| PREDICTED: pentatricopeptide repeat-containi... 110 4e-22 ref|XP_012080232.1| PREDICTED: pentatricopeptide repeat-containi... 103 5e-20 ref|XP_002267998.1| PREDICTED: pentatricopeptide repeat-containi... 97 6e-18 ref|XP_010102436.1| hypothetical protein L484_006119 [Morus nota... 93 7e-17 ref|XP_002511542.1| pentatricopeptide repeat-containing protein,... 92 1e-16 ref|XP_009412940.1| PREDICTED: pentatricopeptide repeat-containi... 84 4e-14 ref|XP_010039060.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_010245702.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_007037265.1| Tetratricopeptide repeat-like superfamily pr... 67 7e-09 ref|XP_011625843.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_010912878.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Elaeis guineensis] Length = 622 Score = 112 bits (281), Expect = 9e-23 Identities = 52/106 (49%), Positives = 77/106 (72%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 ME RLI LL+S L ++Q+KQI+++I++++P LTPLF L SN+ +A FD +P D Sbjct: 1 MEQRLILLLQSPLRSSQLKQINALIVKSHPDLTPLFLGVLLKRSNVGHAQRTFDAIPQPD 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 + NSII+ +KLS+H++VL+T H K TQI+++SIPPVLK+C Sbjct: 61 SYLCNSIITTYSKLSMHKEVLKTFFSVHHKKTQILFHSIPPVLKSC 106 >ref|XP_008776306.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Phoenix dactylifera] Length = 622 Score = 110 bits (275), Expect = 4e-22 Identities = 53/106 (50%), Positives = 75/106 (70%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 ME RLI LL+S L + +KQIH++I+++ P LTPLF L + SN+ YA FD +P D Sbjct: 1 MEQRLILLLQSPLHLSPLKQIHAVIVKSNPDLTPLFLGVLLNRSNMGYAQRAFDAIPQPD 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 P +NSII + +KLS+H++VL+ HRK TQI+++SIP VLK+C Sbjct: 61 PGLSNSIIFSYSKLSMHKEVLKIFFSVHRKKTQILFHSIPSVLKSC 106 >ref|XP_012080232.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Jatropha curcas] gi|643720960|gb|KDP31224.1| hypothetical protein JCGZ_11600 [Jatropha curcas] Length = 610 Score = 103 bits (257), Expect = 5e-20 Identities = 49/106 (46%), Positives = 69/106 (65%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 ME LI+LL S L NQ+KQIHS+II +P L P+ F L + S I+YA VFD++ H D Sbjct: 1 MERNLITLLHSPLRINQLKQIHSLIITKHPTLAPILFKSLLNLSVIDYARQVFDQISHPD 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 F NS+IS KLS+H + ++ + H KN ++ ++ PPV+KAC Sbjct: 61 QFLYNSLISTYTKLSMHIEAVKAFVSMHHKNVRLTCFTAPPVIKAC 106 >ref|XP_002267998.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Vitis vinifera] Length = 618 Score = 96.7 bits (239), Expect = 6e-18 Identities = 49/106 (46%), Positives = 68/106 (64%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 ME LI LL SL NQ+KQI ++II Y LTPLF L + S I+YA VFD++PH D Sbjct: 1 MERYLIDLLHCSLPINQLKQIQALIIIKYLSLTPLFIRRLLNASFIQYARQVFDQIPHPD 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 S I+A ++LSL+ + L T + H+ N +IV ++IPP+ K+C Sbjct: 61 QGVHCSFITAYSRLSLNNEALRTFVSMHQNNVRIVCFTIPPIFKSC 106 >ref|XP_010102436.1| hypothetical protein L484_006119 [Morus notabilis] gi|587905281|gb|EXB93457.1| hypothetical protein L484_006119 [Morus notabilis] Length = 612 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/106 (38%), Positives = 70/106 (66%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 ME L SLL+SSL NQ+KQ+H+++I +P LTP+F L D S + YA +FD++P D Sbjct: 1 MEGYLTSLLQSSLRLNQLKQVHALVITKHPSLTPVFVKKLLDSSAVHYARRLFDKIPQPD 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 N+++ + +KLS++++ LET ++ ++ ++PPV+K+C Sbjct: 61 MHIYNALVCSYSKLSMNKEALETFCSMYQSGIRVFSSTVPPVIKSC 106 >ref|XP_002511542.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550657|gb|EEF52144.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 434 Score = 92.4 bits (228), Expect = 1e-16 Identities = 46/106 (43%), Positives = 67/106 (63%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 ME LI+LL S L NQ+KQIHS+II +P L + L + S+I+YA +FD++P Sbjct: 1 MERTLITLLHSPLQINQLKQIHSLIIIKHPSLATVLVRKLLNLSDIDYARQLFDQVPQPG 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 NS+IS +KLSLH+ L+T H +T++ ++ PPV+KAC Sbjct: 61 QILYNSLISTYSKLSLHKDALKTFFSMHHSDTRLSCFTGPPVIKAC 106 >ref|XP_009412940.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Musa acuminata subsp. malaccensis] Length = 626 Score = 84.0 bits (206), Expect = 4e-14 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 9/115 (7%) Frame = -3 Query: 320 MENRLISLLRSSLDT----NQVKQIHSIIIRAYPKLTPLFFNYL-----SDPSNIEYAHH 168 M R+ISLL S V QIH++++R++P L PLF + L + + +A Sbjct: 1 MRERVISLLHRSPPLPPHHRHVAQIHALLLRSHPDLLPLFLDRLLLGLSPSAAAVRHARK 60 Query: 167 VFDRLPHSDPFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 +FD LP D +S++SA +KLSLH + L AHRK + I++ SIPPVLK+C Sbjct: 61 LFDALPQPDSDLCSSVVSACSKLSLHREALAAFYSAHRKGSPILFLSIPPVLKSC 115 >ref|XP_010039060.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Eucalyptus grandis] Length = 618 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/106 (34%), Positives = 61/106 (57%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 M+ L+ L+RS + +KQIH+++I A+P L L ++YA VFDR+P + Sbjct: 1 MDRDLMKLMRSVKHPSHLKQIHALVIAAFPSLASFLVRRLLSVPMVDYAREVFDRIPQPE 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 +NS+IS ++LS HE+ +E R I Y++PP++K+C Sbjct: 61 QSLSNSLISVYSRLSSHEEAIEAFRSMIRNGVCIDSYTVPPIVKSC 106 >ref|XP_010245702.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Nelumbo nucifera] gi|719974747|ref|XP_010245711.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Nelumbo nucifera] Length = 627 Score = 77.4 bits (189), Expect = 4e-12 Identities = 40/106 (37%), Positives = 61/106 (57%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 ME LISLL+SS+ ++KQIH++I + Y TP F L S ++YA VF+++P D Sbjct: 1 MEQNLISLLQSSVRLKELKQIHALIFKKYISFTPFFIKRLLHLSIVDYARLVFNQVPQPD 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 + S ISA +KLSL+ + + L H +I ++ P L +C Sbjct: 61 QYLYCSFISAYSKLSLYAEAKKMFFLMHHDLARISCFAFSPALSSC 106 >ref|XP_007037265.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508774510|gb|EOY21766.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 707 Score = 66.6 bits (161), Expect = 7e-09 Identities = 40/106 (37%), Positives = 56/106 (52%) Frame = -3 Query: 320 MENRLISLLRSSLDTNQVKQIHSIIIRAYPKLTPLFFNYLSDPSNIEYAHHVFDRLPHSD 141 M L++LL SS NQ KQIHS II LT + L D S + YA VFDR+P D Sbjct: 1 MNPNLLALLHSSDQLNQFKQIHSQIIVNCAALTRILVKKLIDSSFLGYAREVFDRIPLPD 60 Query: 140 PFFANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKAC 3 S IS+ KLS +++ ++ H TQ+ ++ V+K+C Sbjct: 61 QALYISFISSYTKLSFNKEAIKLFASMHSSRTQMSSRAVLAVIKSC 106 >ref|XP_011625843.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Amborella trichopoda] Length = 632 Score = 58.2 bits (139), Expect = 3e-06 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 1/102 (0%) Frame = -3 Query: 308 LISLLRSSLDTNQVKQIHSIIIRAYP-KLTPLFFNYLSDPSNIEYAHHVFDRLPHSDPFF 132 + LL + Q KQIH +I L + L S + YA VFD +P D Sbjct: 12 IFDLLNKCTNLRQFKQIHGYVITTKQCNLNHILVKKLVSFSLMGYARQVFDEIPQPDTTT 71 Query: 131 ANSIISALAKLSLHEKVLETLILAHRKNTQIVYYSIPPVLKA 6 NS++S ++ +H + E L K TQ +S+PPVLKA Sbjct: 72 FNSMLSGFSRAKMHLETTEIYFLMREKQTQFDSFSLPPVLKA 113