BLASTX nr result
ID: Anemarrhena21_contig00037228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00037228 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009002348.1| ribosomal protein S4 (chloroplast) [Orobanch... 62 2e-07 ref|YP_004564006.1| ribosomal protein S4 [Olea woodiana subsp. w... 62 2e-07 emb|CAL37368.1| ribosomal protein S4 [Jasminum arborescens] 62 2e-07 gb|ABG74794.1| ribosomal protein S4 [Jasminum abyssinicum] 62 2e-07 gb|ABG74820.1| ribosomal protein S4 [Jasminum subhumile] 62 2e-07 ref|NP_084786.1| ribosomal protein S4 [Lotus japonicus] gi|26399... 61 3e-07 ref|NP_783234.1| ribosomal protein S4 [Atropa belladonna] gi|351... 61 3e-07 ref|YP_009155214.1| ribosomal protein S4 (plastid) [Pastinaca pi... 61 3e-07 ref|YP_009154788.1| ribosomal protein S4 (chloroplast) [Aster sp... 61 3e-07 ref|YP_009154953.1| ribosomal protein S4 (chloroplast) [Gentiana... 61 3e-07 ref|YP_009144517.1| ribosomal protein S4 (chloroplast) [Rosmarin... 61 3e-07 ref|YP_009141801.1| ribosomal protein S4 (chloroplast) [Vicia sa... 61 3e-07 ref|YP_009141600.1| ribosomal protein S4 (chloroplast) [Medicago... 61 3e-07 ref|YP_009136481.1| ribosomal protein S4 (chloroplast) [Prunus p... 61 3e-07 ref|YP_009136313.1| ribosomal protein S4 (chloroplast) [Prunus y... 61 3e-07 ref|YP_009132838.1| ribosomal protein S4 (chloroplast) [Quercus ... 61 3e-07 ref|YP_009139790.1| ribosomal protein S4 (chloroplast) [Cynara h... 61 3e-07 ref|YP_009127694.1| ribosomal protein S4 (chloroplast) [Prosopis... 61 3e-07 ref|YP_009127432.1| ribosomal protein S4 (chloroplast) [Indigofe... 61 3e-07 ref|YP_009127363.1| ribosomal protein S4 (chloroplast) [Haematox... 61 3e-07 >ref|YP_009002348.1| ribosomal protein S4 (chloroplast) [Orobanche ramosa] gi|575882234|emb|CDL93434.1| ribosomal protein S4 (chloroplast) [Orobanche ramosa] Length = 208 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT*T 93 GLVNQIIDSKWVGLKINELLVVEYYSRQT T Sbjct: 178 GLVNQIIDSKWVGLKINELLVVEYYSRQTKT 208 >ref|YP_004564006.1| ribosomal protein S4 [Olea woodiana subsp. woodiana] gi|334084661|emb|CBS29352.1| ribosomal protein S4 [Olea woodiana subsp. woodiana] Length = 203 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT*T 93 GLVNQIIDSKWVGLKINELLVVEYYSRQT T Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQTET 203 >emb|CAL37368.1| ribosomal protein S4 [Jasminum arborescens] Length = 196 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT*T 93 GLVNQIIDSKWVGLKINELLVVEYYSRQT T Sbjct: 166 GLVNQIIDSKWVGLKINELLVVEYYSRQTKT 196 >gb|ABG74794.1| ribosomal protein S4 [Jasminum abyssinicum] Length = 203 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT*T 93 GLVNQIIDSKWVGLKINELLVVEYYSRQT T Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQTKT 203 >gb|ABG74820.1| ribosomal protein S4 [Jasminum subhumile] Length = 203 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT*T 93 GLVNQIIDSKWVGLKINELLVVEYYSRQT T Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQTKT 203 >ref|NP_084786.1| ribosomal protein S4 [Lotus japonicus] gi|26399164|sp|Q9BBT5.1|RR4_LOTJA RecName: Full=30S ribosomal protein S4, chloroplastic (chloroplast) [Lotus japonicus] gi|13358967|dbj|BAB33184.1| ribosomal protein S4 [Lotus japonicus] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|NP_783234.1| ribosomal protein S4 [Atropa belladonna] gi|351653880|ref|YP_004891605.1| rps4 gene product (chloroplast) [Nicotiana undulata] gi|394831103|ref|YP_006503793.1| ribosomal protein S4 (chloroplast) [Datura stramonium] gi|657302698|ref|YP_009040320.1| ribosomal protein S4 [Hyoscyamus niger] gi|26399142|sp|Q8S8X2.1|RR4_ATRBE RecName: Full=30S ribosomal protein S4, chloroplastic (chloroplast) [Atropa belladonna] gi|20068333|emb|CAC88046.1| ribosomal protein S4 [Atropa belladonna] gi|347453906|gb|AEO95564.1| ribosomal protein S4 (chloroplast) [Nicotiana undulata] gi|347454017|gb|AEO95674.1| ribosomal protein S4 [synthetic construct] gi|350996428|gb|AEQ36940.1| ribosomal protein S4 (chloroplast) [Datura stramonium] gi|350996514|gb|AEQ37025.1| ribosomal protein S4 [Datura stramonium] gi|537366287|gb|AGU46468.1| ribosomal protein S4 [Hyoscyamus niger] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009155214.1| ribosomal protein S4 (plastid) [Pastinaca pimpinellifolia] gi|884997507|ref|YP_009155296.1| ribosomal protein S4 (plastid) [Seseli montanum] gi|700746243|gb|AIU99022.1| ribosomal protein S4 (plastid) [Pastinaca pimpinellifolia] gi|700746346|gb|AIU99104.1| ribosomal protein S4 (plastid) [Seseli montanum] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009154788.1| ribosomal protein S4 (chloroplast) [Aster spathulifolius] gi|549533518|gb|AGX29610.1| ribosomal protein S4 (chloroplast) [Aster spathulifolius] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009154953.1| ribosomal protein S4 (chloroplast) [Gentiana straminea] gi|884997240|ref|YP_009155038.1| ribosomal protein S4 (chloroplast) [Gentiana crassicaulis] gi|658157552|gb|AID57327.1| ribosomal protein S4 (chloroplast) [Gentiana straminea] gi|659105142|gb|AID61137.1| ribosomal protein S4 (chloroplast) [Gentiana crassicaulis] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009144517.1| ribosomal protein S4 (chloroplast) [Rosmarinus officinalis] gi|827345170|gb|AKJ76754.1| ribosomal protein S4 (chloroplast) [Rosmarinus officinalis] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009141801.1| ribosomal protein S4 (chloroplast) [Vicia sativa] gi|675298710|gb|AIL56327.1| ribosomal protein S4 (chloroplast) [Vicia sativa] Length = 198 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 170 GLVNQIIDSKWVGLKINELLVVEYYSRQT 198 >ref|YP_009141600.1| ribosomal protein S4 (chloroplast) [Medicago hybrida] gi|827045337|ref|YP_009141675.1| ribosomal protein S4 (chloroplast) [Medicago papillosa] gi|675298506|gb|AIL56125.1| ribosomal protein S4 (chloroplast) [Medicago hybrida] gi|675298582|gb|AIL56200.1| ribosomal protein S4 (chloroplast) [Medicago papillosa] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009136481.1| ribosomal protein S4 (chloroplast) [Prunus padus] gi|808178361|gb|AKC99691.1| ribosomal protein S4 (chloroplast) [Prunus padus] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009136313.1| ribosomal protein S4 (chloroplast) [Prunus yedoensis] gi|817527571|ref|YP_009136397.1| ribosomal protein S4 (chloroplast) [Prunus maximowiczii] gi|808178190|gb|AKC99522.1| ribosomal protein S4 (chloroplast) [Prunus yedoensis] gi|808178276|gb|AKC99607.1| ribosomal protein S4 (chloroplast) [Prunus maximowiczii] gi|808178446|gb|AKC99775.1| ribosomal protein S4 (chloroplast) [Prunus serrulata var. spontanea] gi|808178531|gb|AKC99859.1| ribosomal protein S4 (chloroplast) [Prunus subhirtella var. subhirtella] gi|808178616|gb|AKC99943.1| ribosomal protein S4 (chloroplast) [Prunus subhirtella var. subhirtella] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009132838.1| ribosomal protein S4 (chloroplast) [Quercus spinosa] gi|800876832|gb|AKA66965.1| ribosomal protein S4 (chloroplast) [Quercus spinosa] Length = 202 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 174 GLVNQIIDSKWVGLKINELLVVEYYSRQT 202 >ref|YP_009139790.1| ribosomal protein S4 (chloroplast) [Cynara humilis] gi|700744622|gb|AIU98546.1| ribosomal protein S4 (chloroplast) [Cynara cardunculus var. scolymus] gi|819231901|gb|AKG49798.1| ribosomal protein S4 (chloroplast) [Cynara humilis] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009127694.1| ribosomal protein S4 (chloroplast) [Prosopis glandulosa] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009127432.1| ribosomal protein S4 (chloroplast) [Indigofera tinctoria] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201 >ref|YP_009127363.1| ribosomal protein S4 (chloroplast) [Haematoxylum brasiletto] Length = 201 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +1 Query: 1 GLVNQIIDSKWVGLKINELLVVEYYSRQT 87 GLVNQIIDSKWVGLKINELLVVEYYSRQT Sbjct: 173 GLVNQIIDSKWVGLKINELLVVEYYSRQT 201