BLASTX nr result
ID: Anemarrhena21_contig00035859
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00035859 (477 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008779274.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_010940571.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_010933122.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_009390256.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 >ref|XP_008779274.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Phoenix dactylifera] gi|672114965|ref|XP_008779281.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Phoenix dactylifera] gi|672114967|ref|XP_008779286.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Phoenix dactylifera] Length = 752 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = -1 Query: 477 PNVVTYSALITGYRKMGDRSKAHKVFKVMLEQAISPNVVTFLA*GL 340 PNVVTY+ALITGYRKMGD KA+K++K+M++Q I P+ L+ GL Sbjct: 699 PNVVTYTALITGYRKMGDWDKAYKLYKIMMKQGILPDASACLSLGL 744 >ref|XP_010940571.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Elaeis guineensis] gi|743853113|ref|XP_010940572.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Elaeis guineensis] gi|743853117|ref|XP_010940573.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Elaeis guineensis] gi|743853121|ref|XP_010940574.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Elaeis guineensis] gi|743853125|ref|XP_010940576.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Elaeis guineensis] gi|743853130|ref|XP_010940577.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Elaeis guineensis] gi|743853134|ref|XP_010940578.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Elaeis guineensis] Length = 733 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/46 (56%), Positives = 39/46 (84%) Frame = -1 Query: 477 PNVVTYSALITGYRKMGDRSKAHKVFKVMLEQAISPNVVTFLA*GL 340 PNVVTY+AL+TGYRKMGD +KA++++K+M++Q I P+ + L+ GL Sbjct: 680 PNVVTYTALVTGYRKMGDWNKAYELYKIMMKQGILPDALACLSLGL 725 >ref|XP_010933122.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Elaeis guineensis] gi|743825846|ref|XP_010933123.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Elaeis guineensis] gi|743825850|ref|XP_010933124.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Elaeis guineensis] gi|743825854|ref|XP_010933126.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Elaeis guineensis] Length = 616 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/46 (54%), Positives = 38/46 (82%) Frame = -1 Query: 477 PNVVTYSALITGYRKMGDRSKAHKVFKVMLEQAISPNVVTFLA*GL 340 PN VTY+ALITGYRKMGD KA++++K+M++Q IS + +T+ + G+ Sbjct: 566 PNEVTYNALITGYRKMGDWDKAYEIYKIMMKQGISSDALTYSSLGI 611 >ref|XP_009390256.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like [Musa acuminata subsp. malaccensis] gi|694995754|ref|XP_009390262.1| PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 733 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/46 (54%), Positives = 39/46 (84%) Frame = -1 Query: 477 PNVVTYSALITGYRKMGDRSKAHKVFKVMLEQAISPNVVTFLA*GL 340 P VVTY+A+ITGYRK+GD +A++V++ ML+Q ISP+ +T+L+ G+ Sbjct: 683 PTVVTYTAVITGYRKLGDWDRAYEVYEFMLKQGISPDALTYLSLGV 728