BLASTX nr result
ID: Anemarrhena21_contig00035436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00035436 (378 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010918509.1| PREDICTED: uncharacterized protein LOC105042... 60 4e-07 >ref|XP_010918509.1| PREDICTED: uncharacterized protein LOC105042862 [Elaeis guineensis] Length = 554 Score = 60.5 bits (145), Expect = 4e-07 Identities = 40/98 (40%), Positives = 59/98 (60%), Gaps = 13/98 (13%) Frame = +3 Query: 96 STPPDLSLSLGCTPSSLVSILKRAAEGF-ETPSIIKRRNQSG------RTINVKDQDVVC 254 STPPDLSLSL C PSS SIL+ AA+GF +TPSII++R ++ + ++ D C Sbjct: 418 STPPDLSLSLACIPSSPESILRSAAKGFKKTPSIIRKRGRNSYKPLFPEKLKMETMDANC 477 Query: 255 GPSE------RAKHVQSIMDNECCHQGATNYRVTGSRN 350 PS RAK+ + +++E HQ +N +V +R+ Sbjct: 478 -PSGVNNFQWRAKNFKDDLESEYVHQTGSNNQVNLNRS 514