BLASTX nr result
ID: Anemarrhena21_contig00034734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00034734 (206 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMS93407.1| hypothetical protein BVRB_031790 [Beta vulgaris s... 107 4e-21 gb|ADI18870.1| hypothetical protein [uncultured Pseudomonadales ... 97 5e-18 ref|WP_014840952.1| hypothetical protein [Legionella pneumophila... 96 7e-18 ref|WP_010946065.1| hydrolase [Legionella pneumophila] gi|528405... 96 9e-18 emb|CDW61002.1| Cell wall-associated hydrolase [Trichuris trichi... 95 2e-17 emb|CDQ29749.1| hypothetical protein BN981_04176 [Halobacillus t... 95 2e-17 gb|EES92061.1| conserved hypothetical protein [Clostridium botul... 95 2e-17 gb|EES91647.1| conserved hypothetical protein [Clostridium botul... 95 2e-17 gb|EDS76152.1| conserved hypothetical protein [Clostridium botul... 95 2e-17 gb|EDS76139.1| conserved hypothetical protein [Clostridium botul... 95 2e-17 gb|ABK62310.1| conserved hypothetical protein [Clostridium novyi... 95 2e-17 gb|ABK60662.1| conserved hypothetical protein [Clostridium novyi... 95 2e-17 emb|CDW60789.1| Cell wall-associated hydrolase [Trichuris trichi... 94 5e-17 gb|AAO34720.1| hypothetical protein CTC_00065 [Clostridium tetan... 94 5e-17 gb|EEP52471.1| conserved hypothetical protein [Clostridium butyr... 94 5e-17 gb|EEP52328.1| conserved hypothetical protein [Clostridium butyr... 94 5e-17 gb|EFG86088.1| hypothetical protein CLCAR_4307 [Clostridium carb... 92 2e-16 gb|ELY20074.1| hypothetical protein HALTITAN_3299 [Halomonas tit... 92 2e-16 gb|EGL81406.1| hypothetical protein CathTA2_0066 [Caldalkalibaci... 92 2e-16 gb|ACO83728.1| conserved hypothetical protein [Clostridium botul... 91 3e-16 >gb|KMS93407.1| hypothetical protein BVRB_031790 [Beta vulgaris subsp. vulgaris] Length = 184 Score = 107 bits (266), Expect = 4e-21 Identities = 49/54 (90%), Positives = 51/54 (94%) Frame = -1 Query: 164 RDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYSLGGDRPSQ 3 RD RITKADFRPCSP+RARSQAPFYLYARCPIANRAEGTF LLRY LGGDRP+Q Sbjct: 6 RDHRITKADFRPCSPHRARSQAPFYLYARCPIANRAEGTFALLRYLLGGDRPNQ 59 >gb|ADI18870.1| hypothetical protein [uncultured Pseudomonadales bacterium HF0010_05E14] Length = 74 Score = 96.7 bits (239), Expect = 5e-18 Identities = 51/68 (75%), Positives = 55/68 (80%) Frame = +3 Query: 3 LTGAVSS*RVTEESKGTLSPVGNRASSVKVEGCLTASPIRRAGTKVGLSDPAVPYGRAVA 182 LTGAVSS RVTEE +GTLS VGN A S KV+ CLTA RAGTKVGLSDP V YGRA+A Sbjct: 4 LTGAVSSQRVTEEREGTLSMVGNHAMSAKVKVCLTARLTSRAGTKVGLSDPVVLYGRAIA 63 Query: 183 QQIKGTPG 206 Q+IKGTPG Sbjct: 64 QRIKGTPG 71 >ref|WP_014840952.1| hypothetical protein [Legionella pneumophila] gi|395126293|emb|CCD04474.1| conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] gi|395128752|emb|CCD06970.1| conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] gi|395129405|emb|CCD07635.1| conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] gi|395129659|emb|CCD07892.1| conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] gi|395131834|emb|CCD10127.1| conserved protein of unknown function [Legionella pneumophila subsp. pneumophila] gi|542119984|gb|ERI46377.1| hypothetical protein N749_17530 [Legionella pneumophila str. Leg01/20] Length = 75 Score = 96.3 bits (238), Expect = 7e-18 Identities = 50/68 (73%), Positives = 54/68 (79%) Frame = +3 Query: 3 LTGAVSS*RVTEESKGTLSPVGNRASSVKVEGCLTASPIRRAGTKVGLSDPAVPYGRAVA 182 LTGAVSS RVTEE KGTL VG+R SVK +GCLTA RAGTKVGLSDP V GRA+A Sbjct: 5 LTGAVSSQRVTEEHKGTLGTVGHRTKSVKAKGCLTARVTARAGTKVGLSDPVVLNGRAIA 64 Query: 183 QQIKGTPG 206 Q+IKGTPG Sbjct: 65 QRIKGTPG 72 >ref|WP_010946065.1| hydrolase [Legionella pneumophila] gi|52840559|ref|YP_094358.1| hypothetical protein lpg0307 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52840813|ref|YP_094612.1| hypothetical protein lpg0574 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52842950|ref|YP_096749.1| hypothetical protein lpg2749 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52627670|gb|AAU26411.1| hypothetical protein lpg0307 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52627924|gb|AAU26665.1| hypothetical protein CTC00065 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|52630061|gb|AAU28802.1| hypothetical CTC00065, TC0129 [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|364507328|gb|AEW50852.1| hypothetical protein lp12_0580 [Legionella pneumophila subsp. pneumophila ATCC 43290] gi|364509453|gb|AEW52977.1| hypothetical protein lp12_2740 [Legionella pneumophila subsp. pneumophila ATCC 43290] Length = 93 Score = 95.9 bits (237), Expect = 9e-18 Identities = 47/68 (69%), Positives = 54/68 (79%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PRSTFY LSDGPSI++ RITK +FR CS +RSQAPF LY +++R EGTF LLRYS Sbjct: 11 PRSTFYPLSDGPSIQNHRITKTNFRSCSSRHSRSQAPFCLYTLGTMSDRTEGTFVLLRYS 70 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 71 LGGDRPSQ 78 >emb|CDW61002.1| Cell wall-associated hydrolase [Trichuris trichiura] Length = 258 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/64 (71%), Positives = 51/64 (79%) Frame = -1 Query: 194 FYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYSLGGD 15 FY LSDGPS+R+ RITK DFRPCS R+RSQAP LY I+N +EGTFG LRYSLGGD Sbjct: 82 FYPLSDGPSMRNHRITKPDFRPCSTCRSRSQAPLCLYTLRMISNHSEGTFGRLRYSLGGD 141 Query: 14 RPSQ 3 RPSQ Sbjct: 142 RPSQ 145 >emb|CDQ29749.1| hypothetical protein BN981_04176 [Halobacillus trueperi] Length = 157 Score = 94.7 bits (234), Expect = 2e-17 Identities = 48/68 (70%), Positives = 55/68 (80%) Frame = +3 Query: 3 LTGAVSS*RVTEESKGTLSPVGNRASSVKVEGCLTASPIRRAGTKVGLSDPAVPYGRAVA 182 LTGAV+S +VTE KG+L VGN + SVK +G LTA P RAGTKVGLSDPAVP+GRAVA Sbjct: 27 LTGAVASQKVTEAPKGSLRMVGNHSQSVKAQGSLTARPTSRAGTKVGLSDPAVPHGRAVA 86 Query: 183 QQIKGTPG 206 Q+IK TPG Sbjct: 87 QRIKATPG 94 >gb|EES92061.1| conserved hypothetical protein [Clostridium botulinum D str. 1873] Length = 210 Score = 94.7 bits (234), Expect = 2e-17 Identities = 47/68 (69%), Positives = 52/68 (76%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGPSI++ RITK DFRPCS RSQAPF L I++RAEGTFG LRY Sbjct: 25 PRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCLCTLRAISDRAEGTFGRLRYL 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >gb|EES91647.1| conserved hypothetical protein [Clostridium botulinum D str. 1873] Length = 213 Score = 94.7 bits (234), Expect = 2e-17 Identities = 47/68 (69%), Positives = 52/68 (76%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGPSI++ RITK DFRPCS RSQAPF L I++RAEGTFG LRY Sbjct: 25 PRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCLCTLRAISDRAEGTFGRLRYL 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >gb|EDS76152.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] Length = 210 Score = 94.7 bits (234), Expect = 2e-17 Identities = 47/68 (69%), Positives = 52/68 (76%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGPSI++ RITK DFRPCS RSQAPF L I++RAEGTFG LRY Sbjct: 25 PRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCLCTLRAISDRAEGTFGRLRYL 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >gb|EDS76139.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] gi|253561008|gb|EES90462.1| conserved hypothetical protein [Clostridium botulinum D str. 1873] Length = 107 Score = 94.7 bits (234), Expect = 2e-17 Identities = 47/68 (69%), Positives = 52/68 (76%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGPSI++ RITK DFRPCS RSQAPF L I++RAEGTFG LRY Sbjct: 25 PRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCLCTLRAISDRAEGTFGRLRYL 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >gb|ABK62310.1| conserved hypothetical protein [Clostridium novyi NT] gi|118135598|gb|ABK62642.1| conserved hypothetical protein [Clostridium novyi NT] gi|169294009|gb|EDS76142.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] gi|169294037|gb|EDS76170.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] gi|169294149|gb|EDS76282.1| conserved hypothetical protein [Clostridium botulinum C str. Eklund] Length = 213 Score = 94.7 bits (234), Expect = 2e-17 Identities = 47/68 (69%), Positives = 52/68 (76%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGPSI++ RITK DFRPCS RSQAPF L I++RAEGTFG LRY Sbjct: 25 PRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCLCTLRAISDRAEGTFGRLRYL 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >gb|ABK60662.1| conserved hypothetical protein [Clostridium novyi NT] gi|118133692|gb|ABK60736.1| conserved hypothetical protein [Clostridium novyi NT] gi|118133818|gb|ABK60862.1| conserved hypothetical protein [Clostridium novyi NT] gi|118133980|gb|ABK61024.1| conserved hypothetical protein [Clostridium novyi NT] gi|118134492|gb|ABK61536.1| conserved hypothetical protein [Clostridium novyi NT] gi|118135360|gb|ABK62404.1| conserved hypothetical protein [Clostridium novyi NT] gi|118135600|gb|ABK62644.1| conserved hypothetical protein [Clostridium novyi NT] gi|118135607|gb|ABK62651.1| conserved hypothetical protein [Clostridium novyi NT] Length = 213 Score = 94.7 bits (234), Expect = 2e-17 Identities = 47/68 (69%), Positives = 52/68 (76%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGPSI++ RITK DFRPCS RSQAPF L I++RAEGTFG LRY Sbjct: 25 PRGSFYPLSDGPSIQNHRITKPDFRPCSTCMCRSQAPFCLCTLRAISDRAEGTFGRLRYL 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >emb|CDW60789.1| Cell wall-associated hydrolase [Trichuris trichiura] Length = 215 Score = 93.6 bits (231), Expect = 5e-17 Identities = 45/64 (70%), Positives = 50/64 (78%) Frame = -1 Query: 194 FYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYSLGGD 15 FY LSDGPS+R+ RITK DFRPCS +RSQAP YLY I+N +EGTFG LRY LGGD Sbjct: 42 FYPLSDGPSMRNHRITKPDFRPCSSCSSRSQAPLYLYTLRMISNHSEGTFGRLRYLLGGD 101 Query: 14 RPSQ 3 RPSQ Sbjct: 102 RPSQ 105 >gb|AAO34720.1| hypothetical protein CTC_00065 [Clostridium tetani E88] gi|28202296|gb|AAO34742.1| hypothetical protein CTC_00089 [Clostridium tetani E88] gi|28202416|gb|AAO34862.1| hypothetical protein CTC_00214 [Clostridium tetani E88] gi|28202724|gb|AAO35169.1| hypothetical protein CTC_00549 [Clostridium tetani E88] gi|154816039|emb|CAO85713.1| hypothetical CTC00065-like protein [Clostridium sp.] Length = 218 Score = 93.6 bits (231), Expect = 5e-17 Identities = 46/68 (67%), Positives = 50/68 (73%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGP R+ RITK DFRPCS RSQAP LY I++RAEGTFG LRY Sbjct: 25 PRGSFYPLSDGPPTRNHRITKPDFRPCSTCMCRSQAPLCLYTLRAISDRAEGTFGRLRYF 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >gb|EEP52471.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] Length = 115 Score = 93.6 bits (231), Expect = 5e-17 Identities = 46/68 (67%), Positives = 51/68 (75%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGP R RITK DFRPCS R+RSQAP LY I++R+EGTFG LRY Sbjct: 25 PRGSFYPLSDGPPTRYHRITKPDFRPCSTCRSRSQAPLCLYTLRTISDRSEGTFGRLRYI 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >gb|EEP52328.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237654847|gb|EEP52409.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237654906|gb|EEP52467.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237655030|gb|EEP52590.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237655037|gb|EEP52596.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237657073|gb|EEP54629.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237657782|gb|EEP55337.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237657973|gb|EEP55528.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] gi|237658308|gb|EEP55861.1| conserved hypothetical protein [Clostridium butyricum E4 str. BoNT E BL5262] Length = 127 Score = 93.6 bits (231), Expect = 5e-17 Identities = 46/68 (67%), Positives = 51/68 (75%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGP R RITK DFRPCS R+RSQAP LY I++R+EGTFG LRY Sbjct: 25 PRGSFYPLSDGPPTRYHRITKPDFRPCSTCRSRSQAPLCLYTLRTISDRSEGTFGRLRYI 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92 >gb|EFG86088.1| hypothetical protein CLCAR_4307 [Clostridium carboxidivorans P7] Length = 230 Score = 91.7 bits (226), Expect = 2e-16 Identities = 45/68 (66%), Positives = 49/68 (72%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGP R+ RITK DFRPCS RSQAPF L I+NR+EGTFG LRY Sbjct: 25 PRGSFYPLSDGPPTRNHRITKPDFRPCSTCMCRSQAPFCLCTLRTISNRSEGTFGRLRYF 84 Query: 26 LGGDRPSQ 3 GGDRPSQ Sbjct: 85 FGGDRPSQ 92 >gb|ELY20074.1| hypothetical protein HALTITAN_3299 [Halomonas titanicae BH1] Length = 163 Score = 91.7 bits (226), Expect = 2e-16 Identities = 45/68 (66%), Positives = 53/68 (77%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PRSTFY LSDGPSI++ RIT+ FR CS +RSQAP +C +++RAEGTF LLRYS Sbjct: 18 PRSTFYPLSDGPSIQNHRITRTCFRTCSTCLSRSQAPLCSCTQCTMSDRAEGTFVLLRYS 77 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 78 LGGDRPSQ 85 >gb|EGL81406.1| hypothetical protein CathTA2_0066 [Caldalkalibacillus thermarum TA2.A1] Length = 109 Score = 91.7 bits (226), Expect = 2e-16 Identities = 47/68 (69%), Positives = 53/68 (77%) Frame = +3 Query: 3 LTGAVSS*RVTEESKGTLSPVGNRASSVKVEGCLTASPIRRAGTKVGLSDPAVPYGRAVA 182 LTGAV+S +VTE KG+LS VGN A S K EG LTA RAGTKVGLSDP VP+GRA+A Sbjct: 39 LTGAVASQKVTEAPKGSLSMVGNHAQSAKAEGSLTARLTSRAGTKVGLSDPVVPHGRAIA 98 Query: 183 QQIKGTPG 206 Q+IK TPG Sbjct: 99 QRIKATPG 106 >gb|ACO83728.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226842971|gb|ACO85637.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226844394|gb|ACO87060.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226844546|gb|ACO87212.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] Length = 218 Score = 90.9 bits (224), Expect = 3e-16 Identities = 46/68 (67%), Positives = 49/68 (72%) Frame = -1 Query: 206 PRSTFYLLSDGPSIRDRRITKADFRPCSPYRARSQAPFYLYARCPIANRAEGTFGLLRYS 27 PR +FY LSDGP R RITK DFRPCS RSQAPF L I++RAEGTFG LRY Sbjct: 25 PRGSFYPLSDGPPTRYHRITKPDFRPCSTCMCRSQAPFCLCTLRAISDRAEGTFGRLRYF 84 Query: 26 LGGDRPSQ 3 LGGDRPSQ Sbjct: 85 LGGDRPSQ 92