BLASTX nr result
ID: Anemarrhena21_contig00034296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00034296 (272 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM93391.1| hypothetical protein AMTR_s05614p00001110, partia... 59 2e-06 >gb|ERM93391.1| hypothetical protein AMTR_s05614p00001110, partial [Amborella trichopoda] Length = 509 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/70 (40%), Positives = 40/70 (57%) Frame = +1 Query: 61 PSNVMLSKRKRHPPVRFENYTDPTSKKVKQIVLHPLQKPSSKHLSMFKRWLIGDIDNFAL 240 P+ V KRKR PPV F +YT+ + PL+ P K L+ F++W +G I N L Sbjct: 360 PAVVKSRKRKRKPPVWFGDYTEMKRRHRPSSTFDPLEPPDEKLLTTFRKWCVGLIPNHRL 419 Query: 241 RDVKTEDVGP 270 RD+++ D GP Sbjct: 420 RDLRSGDYGP 429