BLASTX nr result
ID: Anemarrhena21_contig00034076
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00034076 (498 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009407929.1| PREDICTED: protein transport protein SFT2-li... 57 4e-06 >ref|XP_009407929.1| PREDICTED: protein transport protein SFT2-like [Musa acuminata subsp. malaccensis] Length = 227 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = -2 Query: 98 AIFKVLALAYYAISYFPGGAAGLKFISSTLTS 3 ++ +VLALAYYAISYFPGG+AGLKF+SSTLTS Sbjct: 188 SVIQVLALAYYAISYFPGGSAGLKFLSSTLTS 219