BLASTX nr result
ID: Anemarrhena21_contig00031364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00031364 (203 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007161440.1| hypothetical protein PHAVU_001G068900g [Phas... 56 8e-06 ref|XP_007138186.1| hypothetical protein PHAVU_009G187600g [Phas... 56 8e-06 >ref|XP_007161440.1| hypothetical protein PHAVU_001G068900g [Phaseolus vulgaris] gi|561034904|gb|ESW33434.1| hypothetical protein PHAVU_001G068900g [Phaseolus vulgaris] Length = 249 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 2/60 (3%) Frame = +1 Query: 1 LYDLPLEYRCPTNLFNIARGIGIPLKVDQRSQRSG--TYARVQVDVDFSKPLRDKVLIQR 174 +Y LPL+Y P +F+I RGIGIPL +D + R +ARV VD+D P D++L++R Sbjct: 133 IYHLPLKYWRPRAIFSITRGIGIPLSLDDHTMRKNRCLFARVFVDIDLLSPFPDQLLVER 192 >ref|XP_007138186.1| hypothetical protein PHAVU_009G187600g [Phaseolus vulgaris] gi|561011273|gb|ESW10180.1| hypothetical protein PHAVU_009G187600g [Phaseolus vulgaris] Length = 218 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/57 (49%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = +1 Query: 10 LPLEYRCPTNLFNIARGIGIPLKVDQRSQRS--GTYARVQVDVDFSKPLRDKVLIQR 174 LPLEY P +F+I RG+GIPL +D+ + R G ARV VD+D PL D +L++R Sbjct: 95 LPLEYWKPRAIFSIIRGLGIPLSLDEHTMRKNRGMLARVLVDIDLLSPLPDHLLVER 151