BLASTX nr result
ID: Anemarrhena21_contig00030680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00030680 (358 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010915772.1| PREDICTED: uncharacterized protein LOC105040... 57 5e-06 >ref|XP_010915772.1| PREDICTED: uncharacterized protein LOC105040784 isoform X1 [Elaeis guineensis] Length = 793 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (2%) Frame = -2 Query: 234 TGGCGQGLWHLAAPEISKPDHSAQLFAAAAILYEMANCSNAIRAQSDTFVRIKWP--SSE 61 + GC Q + P+ISKP +S + AA IL EM +CSNAI+ +S RIKWP SS+ Sbjct: 595 SSGCDQNSRYFPTPKISKPGYSPMVLLAAEILCEMGHCSNAIKTRSHDSGRIKWPKTSSQ 654 Query: 60 NNIGDRRS 37 + R+S Sbjct: 655 KTMKARKS 662