BLASTX nr result
ID: Anemarrhena21_contig00030602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00030602 (650 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010907242.1| PREDICTED: U-box domain-containing protein 9... 62 2e-07 ref|XP_008811326.1| PREDICTED: U-box domain-containing protein 9... 61 6e-07 ref|XP_010908320.1| PREDICTED: U-box domain-containing protein 9... 59 2e-06 ref|XP_008460394.1| PREDICTED: U-box domain-containing protein 9... 59 2e-06 ref|XP_009379990.1| PREDICTED: U-box domain-containing protein 9... 59 2e-06 ref|XP_012466040.1| PREDICTED: U-box domain-containing protein 9... 58 5e-06 gb|KHG16436.1| U-box domain-containing 9 -like protein [Gossypiu... 58 5e-06 ref|XP_012856953.1| PREDICTED: U-box domain-containing protein 9... 58 5e-06 ref|XP_012492311.1| PREDICTED: U-box domain-containing protein 9... 57 6e-06 gb|KHG24446.1| U-box domain-containing 9 -like protein [Gossypiu... 57 6e-06 ref|XP_009593412.1| PREDICTED: U-box domain-containing protein 9... 57 6e-06 ref|XP_007049638.1| U-box domain-containing protein 9 [Theobroma... 57 6e-06 ref|XP_004144394.1| PREDICTED: U-box domain-containing protein 9... 57 6e-06 ref|XP_008778975.1| PREDICTED: U-box domain-containing protein 9... 57 8e-06 gb|EEC73195.1| hypothetical protein OsI_07255 [Oryza sativa Indi... 57 8e-06 ref|NP_001150782.1| LOC100284415 [Zea mays] gi|195641774|gb|ACG4... 57 8e-06 ref|XP_006648643.1| PREDICTED: U-box domain-containing protein 9... 57 8e-06 dbj|BAD22116.1| Avr9/Cf-9 rapidly elicited protein-like [Oryza s... 57 8e-06 ref|XP_003574980.1| PREDICTED: U-box domain-containing protein 9... 57 8e-06 ref|NP_001172966.1| Os02g0488701, partial [Oryza sativa Japonica... 57 8e-06 >ref|XP_010907242.1| PREDICTED: U-box domain-containing protein 9-like [Elaeis guineensis] Length = 468 Score = 62.4 bits (150), Expect = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQEWLNSGNRTCPQTQQ+L N Sbjct: 108 QTYDRPFIQEWLNSGNRTCPQTQQILPN 135 >ref|XP_008811326.1| PREDICTED: U-box domain-containing protein 9-like [Phoenix dactylifera] Length = 469 Score = 60.8 bits (146), Expect = 6e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTY+RPFIQEWLNSGNRTCPQTQQ+L N Sbjct: 109 QTYERPFIQEWLNSGNRTCPQTQQILPN 136 >ref|XP_010908320.1| PREDICTED: U-box domain-containing protein 9-like, partial [Elaeis guineensis] Length = 380 Score = 59.3 bits (142), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 112 VLLQTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 +LLQTYDR FIQEWLNSGNR CPQT+QVL N Sbjct: 17 LLLQTYDRAFIQEWLNSGNRICPQTRQVLPN 47 >ref|XP_008460394.1| PREDICTED: U-box domain-containing protein 9 [Cucumis melo] Length = 461 Score = 59.3 bits (142), Expect = 2e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTNPD 14 +TYDRPFIQ+WLNSGNRTCP+TQQVL++ D Sbjct: 96 ETYDRPFIQKWLNSGNRTCPRTQQVLSHTD 125 >ref|XP_009379990.1| PREDICTED: U-box domain-containing protein 9 [Musa acuminata subsp. malaccensis] Length = 480 Score = 58.9 bits (141), Expect = 2e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQEWLNSGNRTCPQ+ Q+L N Sbjct: 117 QTYDRPFIQEWLNSGNRTCPQSHQILPN 144 >ref|XP_012466040.1| PREDICTED: U-box domain-containing protein 9-like [Gossypium raimondii] gi|763817237|gb|KJB84084.1| hypothetical protein B456_N004700 [Gossypium raimondii] Length = 464 Score = 57.8 bits (138), Expect = 5e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQ+WLN+GNRTCPQT+QVL++ Sbjct: 103 QTYDRPFIQKWLNAGNRTCPQTEQVLSH 130 >gb|KHG16436.1| U-box domain-containing 9 -like protein [Gossypium arboreum] Length = 464 Score = 57.8 bits (138), Expect = 5e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQ+WLN+GNRTCPQT+QVL++ Sbjct: 103 QTYDRPFIQKWLNAGNRTCPQTEQVLSH 130 >ref|XP_012856953.1| PREDICTED: U-box domain-containing protein 9-like [Erythranthe guttatus] gi|604301475|gb|EYU21095.1| hypothetical protein MIMGU_mgv1a005997mg [Erythranthe guttata] Length = 461 Score = 57.8 bits (138), Expect = 5e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQ+WL SGNRTCP+TQQVLT+ Sbjct: 101 QTYDRPFIQKWLKSGNRTCPKTQQVLTH 128 >ref|XP_012492311.1| PREDICTED: U-box domain-containing protein 9-like [Gossypium raimondii] gi|763743371|gb|KJB10870.1| hypothetical protein B456_001G229800 [Gossypium raimondii] gi|763743372|gb|KJB10871.1| hypothetical protein B456_001G229800 [Gossypium raimondii] Length = 459 Score = 57.4 bits (137), Expect = 6e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQ+WLN+GNRTCP+TQQVL++ Sbjct: 98 QTYDRPFIQKWLNAGNRTCPRTQQVLSH 125 >gb|KHG24446.1| U-box domain-containing 9 -like protein [Gossypium arboreum] Length = 459 Score = 57.4 bits (137), Expect = 6e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQ+WLN+GNRTCP+TQQVL++ Sbjct: 98 QTYDRPFIQKWLNAGNRTCPRTQQVLSH 125 >ref|XP_009593412.1| PREDICTED: U-box domain-containing protein 9 [Nicotiana tomentosiformis] Length = 458 Score = 57.4 bits (137), Expect = 6e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQ+WLN+GNRTCP+TQQVL++ Sbjct: 99 QTYDRPFIQKWLNAGNRTCPRTQQVLSH 126 >ref|XP_007049638.1| U-box domain-containing protein 9 [Theobroma cacao] gi|508701899|gb|EOX93795.1| U-box domain-containing protein 9 [Theobroma cacao] Length = 462 Score = 57.4 bits (137), Expect = 6e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQ+WLN+GNRTCP+TQQVL++ Sbjct: 101 QTYDRPFIQKWLNAGNRTCPRTQQVLSH 128 >ref|XP_004144394.1| PREDICTED: U-box domain-containing protein 9 [Cucumis sativus] gi|700203247|gb|KGN58380.1| hypothetical protein Csa_3G634320 [Cucumis sativus] Length = 461 Score = 57.4 bits (137), Expect = 6e-06 Identities = 23/28 (82%), Positives = 28/28 (100%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 +TYDRPFIQ+WLNSGNRTCP+TQQVL++ Sbjct: 96 ETYDRPFIQKWLNSGNRTCPRTQQVLSH 123 >ref|XP_008778975.1| PREDICTED: U-box domain-containing protein 9-like [Phoenix dactylifera] Length = 445 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDRPFIQEWLNSG+R CPQT+QVL N Sbjct: 85 QTYDRPFIQEWLNSGSRICPQTRQVLPN 112 >gb|EEC73195.1| hypothetical protein OsI_07255 [Oryza sativa Indica Group] Length = 372 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDR FIQEWL++GNRTCPQTQQVL+N Sbjct: 11 QTYDRRFIQEWLSAGNRTCPQTQQVLSN 38 >ref|NP_001150782.1| LOC100284415 [Zea mays] gi|195641774|gb|ACG40355.1| spotted leaf protein 11 [Zea mays] gi|413936910|gb|AFW71461.1| spotted leaf protein 11 [Zea mays] Length = 465 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDR FIQEWL++GNRTCPQTQQVL+N Sbjct: 96 QTYDRRFIQEWLSAGNRTCPQTQQVLSN 123 >ref|XP_006648643.1| PREDICTED: U-box domain-containing protein 9-like, partial [Oryza brachyantha] Length = 405 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDR FIQEWL++GNRTCPQTQQVL+N Sbjct: 44 QTYDRRFIQEWLSAGNRTCPQTQQVLSN 71 >dbj|BAD22116.1| Avr9/Cf-9 rapidly elicited protein-like [Oryza sativa Japonica Group] gi|47848077|dbj|BAD21861.1| Avr9/Cf-9 rapidly elicited protein-like [Oryza sativa Japonica Group] Length = 467 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDR FIQEWL++GNRTCPQTQQVL+N Sbjct: 106 QTYDRRFIQEWLSAGNRTCPQTQQVLSN 133 >ref|XP_003574980.1| PREDICTED: U-box domain-containing protein 9-like [Brachypodium distachyon] Length = 463 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDR FIQEWL++GNRTCPQTQQVL+N Sbjct: 101 QTYDRRFIQEWLSAGNRTCPQTQQVLSN 128 >ref|NP_001172966.1| Os02g0488701, partial [Oryza sativa Japonica Group] gi|255670908|dbj|BAH91695.1| Os02g0488701, partial [Oryza sativa Japonica Group] Length = 423 Score = 57.0 bits (136), Expect = 8e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -2 Query: 103 QTYDRPFIQEWLNSGNRTCPQTQQVLTN 20 QTYDR FIQEWL++GNRTCPQTQQVL+N Sbjct: 62 QTYDRRFIQEWLSAGNRTCPQTQQVLSN 89