BLASTX nr result
ID: Anemarrhena21_contig00026194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00026194 (231 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAD12068.2| putative MADS600 protein [Asarum caudigerum] 72 2e-10 ref|XP_009625300.1| PREDICTED: MADS-box protein CMB1-like [Nicot... 71 2e-10 dbj|BAC53738.1| PnSAH1 [Ipomoea nil] 71 3e-10 ref|XP_011008142.1| PREDICTED: truncated transcription factor CA... 71 3e-10 gb|AIU94288.1| APETALA1-like protein [Prunus pseudocerasus] 71 3e-10 ref|XP_008243811.1| PREDICTED: truncated transcription factor CA... 71 3e-10 gb|ACS74807.2| APETALA1-like protein 2 [Rosa hybrid cultivar] 71 3e-10 ref|NP_001268210.1| apetala1 [Vitis vinifera] gi|269116074|gb|AC... 71 3e-10 gb|ACD62902.1| fruitfull-like protein [Ipomoea nil] 71 3e-10 gb|AAF12699.2| PTM1 [Populus tremuloides] 71 3e-10 gb|AAY82244.1| SAP1 [Salix discolor] 71 3e-10 gb|AAY82245.1| SAP1 [Salix discolor] 71 3e-10 gb|AHB33337.1| APETALA1, partial [Populus simonii x Populus nigra] 71 3e-10 ref|XP_006384289.1| hypothetical protein POPTR_0004s11430g [Popu... 71 3e-10 ref|XP_002311353.2| AP1-like family protein [Populus trichocarpa... 71 3e-10 dbj|BAK18783.2| MASDS-box protein [Pyrus pyrifolia var. culta] 71 3e-10 ref|XP_004297215.1| PREDICTED: truncated transcription factor CA... 71 3e-10 gb|ACT67688.1| APETALA1-like protein [Prunus serrulata var. lann... 71 3e-10 ref|XP_007223821.1| hypothetical protein PRUPE_ppa010723mg [Prun... 71 3e-10 gb|ABG85297.1| MADS-box protein 5 [Malus domestica] 71 3e-10 >emb|CAD12068.2| putative MADS600 protein [Asarum caudigerum] Length = 301 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/39 (92%), Positives = 36/39 (92%) Frame = -2 Query: 119 LSVMGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 L MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 54 LQEMGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 92 >ref|XP_009625300.1| PREDICTED: MADS-box protein CMB1-like [Nicotiana tomentosiformis] Length = 256 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/44 (79%), Positives = 40/44 (90%) Frame = -2 Query: 134 ISLH*LSVMGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 ISL +S+MGRGRV+LKRIEN INRQVTFSKRR GLLKKA+E+S Sbjct: 21 ISLREISIMGRGRVELKRIENKINRQVTFSKRRNGLLKKAYELS 64 >dbj|BAC53738.1| PnSAH1 [Ipomoea nil] Length = 247 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >ref|XP_011008142.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like [Populus euphratica] Length = 255 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|AIU94288.1| APETALA1-like protein [Prunus pseudocerasus] Length = 238 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >ref|XP_008243811.1| PREDICTED: truncated transcription factor CAULIFLOWER A-like [Prunus mume] Length = 238 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|ACS74807.2| APETALA1-like protein 2 [Rosa hybrid cultivar] Length = 247 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >ref|NP_001268210.1| apetala1 [Vitis vinifera] gi|269116074|gb|ACZ26528.1| apetala1 [Vitis vinifera] Length = 241 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|ACD62902.1| fruitfull-like protein [Ipomoea nil] Length = 250 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|AAF12699.2| PTM1 [Populus tremuloides] Length = 248 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|AAY82244.1| SAP1 [Salix discolor] Length = 250 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|AAY82245.1| SAP1 [Salix discolor] Length = 250 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|AHB33337.1| APETALA1, partial [Populus simonii x Populus nigra] Length = 250 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >ref|XP_006384289.1| hypothetical protein POPTR_0004s11430g [Populus trichocarpa] gi|550340836|gb|ERP62086.1| hypothetical protein POPTR_0004s11430g [Populus trichocarpa] Length = 121 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >ref|XP_002311353.2| AP1-like family protein [Populus trichocarpa] gi|550332746|gb|EEE88720.2| AP1-like family protein [Populus trichocarpa] Length = 241 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >dbj|BAK18783.2| MASDS-box protein [Pyrus pyrifolia var. culta] Length = 239 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >ref|XP_004297215.1| PREDICTED: truncated transcription factor CAULIFLOWER A [Fragaria vesca subsp. vesca] gi|375173406|gb|AFA42326.1| AP1-like transcription factor [Fragaria x ananassa] Length = 245 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|ACT67688.1| APETALA1-like protein [Prunus serrulata var. lannesiana] Length = 238 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >ref|XP_007223821.1| hypothetical protein PRUPE_ppa010723mg [Prunus persica] gi|156454654|gb|ABU63953.1| APETALA1-like protein [Prunus persica] gi|462420757|gb|EMJ25020.1| hypothetical protein PRUPE_ppa010723mg [Prunus persica] Length = 238 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36 >gb|ABG85297.1| MADS-box protein 5 [Malus domestica] Length = 239 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 110 MGRGRVQLKRIENTINRQVTFSKRRTGLLKKAHEIS 3 MGRGRVQLKRIEN INRQVTFSKRRTGLLKKAHEIS Sbjct: 1 MGRGRVQLKRIENKINRQVTFSKRRTGLLKKAHEIS 36